BLASTX nr result
ID: Jatropha_contig00034346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034346 (690 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 65 1e-08 tpg|DAA63803.1| TPA: hypothetical protein ZEAMMB73_892641 [Zea m... 64 6e-08 gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus cl... 61 3e-07 gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [... 60 8e-07 gb|ADE77881.1| unknown [Picea sitchensis] 59 1e-06 ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus ... 59 1e-06 gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus... 59 2e-06 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 58 2e-06 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 58 2e-06 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 58 3e-06 ref|XP_002329989.1| stress-induced hydrophobic peptide [Populus ... 58 3e-06 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 58 3e-06 gb|ESW17045.1| hypothetical protein PHAVU_007G205900g [Phaseolus... 58 3e-06 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 58 3e-06 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 58 3e-06 ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG2... 58 3e-06 ref|XP_002318921.1| stress-induced hydrophobic peptide [Populus ... 57 4e-06 ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|2269... 57 4e-06 gb|AEW07683.1| Pinus taeda anonymous locus 0_8695_01 genomic seq... 57 5e-06 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 57 5e-06 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +1 Query: 76 MPSEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 MPSEGTATCIDILLAVILPPLGVFLKFGCK + CLL++ Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAE---------FWICLLLT 40 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 351 QAEFWICLLLTILGYIPGIIYAVYAITK 434 +AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 30 KAEFWICLLLTILGYIPGIIYAVYAITK 57 >tpg|DAA63803.1| TPA: hypothetical protein ZEAMMB73_892641 [Zea mays] Length = 56 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 82 SEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*I-SVMYFCLLVSSA 228 S+GTATCIDI+LA+ILPPLGVF KFGC VR +S S FCLL SA Sbjct: 2 SDGTATCIDIILAIILPPLGVFFKFGCGVRDFLISTTSSAAAFCLLCCSA 51 >gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 76 MPSEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 M EGTATCIDI+LA+ILPPLGVFLKFGCKV + CLL++ Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVE---------FWICLLLT 40 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 351 QAEFWICLLLTILGYIPGIIYAVYAITK 434 + EFWICLLLTI GYIPGIIYAVYAITK Sbjct: 30 KVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 351 QAEFWICLLLTILGYIPGIIYAVYAITK 434 +AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 76 KAEFWICLLLTILGYIPGIIYAVYAITK 103 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +1 Query: 67 ERKMPSEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 + KM TATC+DILLAVILPPLGVFLKFGCK + CLL++ Sbjct: 44 QSKMADGSTATCVDILLAVILPPLGVFLKFGCKAE---------FWICLLLT 86 >gb|ADE77881.1| unknown [Picea sitchensis] Length = 53 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 354 AEFWICLLLTILGYIPGIIYAVYAITK 434 AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 27 AEFWICLLLTILGYIPGIIYAVYAITK 53 >ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 57 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +1 Query: 76 MPSEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 M EGTATCIDILLA+ILPPLGVFLKFGC V + CLL++ Sbjct: 1 MADEGTATCIDILLAIILPPLGVFLKFGCGVE---------FWICLLLT 40 >gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris] Length = 57 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 333 YWKKFLQAEFWICLLLTILGYIPGIIYAVYAITK 434 + K + EFWICLLLTILGYIPGIIYAVYAITK Sbjct: 24 FLKHGCKVEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 351 QAEFWICLLLTILGYIPGIIYAVYAITK 434 +AEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 27 KAEFWICLLLTILGYIPGIIYAVYVITK 54 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 88 GTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 GTATC+DI+LAVILPPLGVFLKFGCK + CLL++ Sbjct: 2 GTATCVDIILAVILPPLGVFLKFGCKAE---------FWICLLLT 37 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +1 Query: 82 SEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 S+GTA CIDIL+A+ILPPLGVFLKFGCKV + CLL++ Sbjct: 2 SDGTANCIDILIAIILPPLGVFLKFGCKVE---------FWLCLLLT 39 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 351 QAEFWICLLLTILGYIPGIIYAVYAITK 434 + EFWICLLLTILGYIPGIIYA+YAITK Sbjct: 27 KVEFWICLLLTILGYIPGIIYAIYAITK 54 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 88 GTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 GTATC+DI+LA+ILPPLGVFL+FGCKV + CLL++ Sbjct: 2 GTATCVDIILAIILPPLGVFLRFGCKVE---------FWICLLLT 37 >ref|XP_002329989.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|550337608|gb|ERP60053.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa] Length = 55 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 357 EFWICLLLTILGYIPGIIYAVYAITK 434 EFWICLLLTILGYIPGIIYAVYAITK Sbjct: 30 EFWICLLLTILGYIPGIIYAVYAITK 55 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 354 AEFWICLLLTILGYIPGIIYAVYAITK 434 AEFWICLLLTILGY+PGI+YA+YAITK Sbjct: 30 AEFWICLLLTILGYLPGIVYAIYAITK 56 >gb|ESW17045.1| hypothetical protein PHAVU_007G205900g [Phaseolus vulgaris] Length = 62 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 76 MPSEGTATCIDILLAVILPPLGVFLKFGCKV 168 M +G+ATCIDILLA+ILPPLGVFLK+GCKV Sbjct: 1 MAGDGSATCIDILLAIILPPLGVFLKYGCKV 31 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = +1 Query: 82 SEGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVSSAHIFLG 243 SEGTA CIDIL+A+ILPPLGVFLKFGCK + CLL++ FLG Sbjct: 2 SEGTANCIDILIAIILPPLGVFLKFGCKFE---------FWICLLLT----FLG 42 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +1 Query: 85 EGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVSSAHIFLG 243 EGTA C+DIL+A+ILPPLGVFLKFGCKV + CLL++ FLG Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVE---------FWLCLLLT----FLG 42 >ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays] gi|413946837|gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 85 EGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 EGTA CIDIL+A+ILPPLGVFLKFGCKV + CLL++ Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKVE---------FWLCLLLT 39 >ref|XP_002318921.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|222857297|gb|EEE94844.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa] gi|550324620|gb|ERP53504.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa] gi|550324621|gb|ERP53505.1| Hydrophobic protein RCI2A [Populus trichocarpa] gi|550324622|gb|ERP53506.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa] Length = 54 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 354 AEFWICLLLTILGYIPGIIYAVYAITK 434 AEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 28 AEFWICLLLTILGYIPGIIYAVYIITK 54 >ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|226958659|ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays] gi|195648282|gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays] gi|195650163|gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays] gi|414877124|tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +1 Query: 85 EGTATCIDILLAVILPPLGVFLKFGCKVRSTSVS*ISVMYFCLLVS 222 EGTA C+DIL+A+ILPPLGVFLKFGCKV + CLL++ Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVE---------FWLCLLLT 39 >gb|AEW07683.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence gi|383154617|gb|AFG59450.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence gi|383154619|gb|AFG59451.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence gi|383154621|gb|AFG59452.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence gi|383154623|gb|AFG59453.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence gi|383154625|gb|AFG59454.1| Pinus taeda anonymous locus 0_8695_01 genomic sequence Length = 64 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 333 YWKKFLQAEFWICLLLTILGYIPGIIYAVYAITK 434 ++K AEFWICLLLTILG+IPGIIYA+YAIT+ Sbjct: 28 FFKYGCHAEFWICLLLTILGFIPGIIYAIYAITQ 61 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 76 MPSEGTATCIDILLAVILPPLGVFLKFGCKV 168 M + TATCIDILLA+ILPPLGVFLK+GCKV Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKYGCKV 31