BLASTX nr result
ID: Jatropha_contig00034249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034249 (271 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] 60 3e-07 gb|ABP01767.1| ptoteinase inhibitor 2 [Salvia miltiorrhiza] 57 3e-06 >gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] Length = 70 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 2 VNPIVLNERSPVTPDFRCDRVRVFVNDCGVVVRVPIV 112 VN IVL E +PVT DFRCDRV V+VN+CGVVVRVPI+ Sbjct: 33 VNAIVLKEGTPVTRDFRCDRVWVWVNECGVVVRVPII 69 >gb|ABP01767.1| ptoteinase inhibitor 2 [Salvia miltiorrhiza] Length = 71 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +2 Query: 2 VNPIVLNERSPVTPDFRCDRVRVFVNDCGVVVRVPIV 112 VNP++ E P+T DFRCDRV VFVND G+V RVP+V Sbjct: 34 VNPLIWGENQPITRDFRCDRVFVFVNDSGIVTRVPMV 70