BLASTX nr result
ID: Jatropha_contig00034169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034169 (604 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY63297.1| DREB protein [Populus pruinosa] 57 3e-06 gb|ABU86872.1| dehydrate responsive element-binding protein [Pop... 57 3e-06 ref|XP_002307098.1| AP2/ERF domain-containing transcription fact... 56 8e-06 >gb|ABY63297.1| DREB protein [Populus pruinosa] Length = 291 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 465 MAAAIDIYNSKTAPVFSVMDPCREELMKALEPFMK 569 MAAAIDIYN+ TAPVFS DPCREELMKALEPFMK Sbjct: 1 MAAAIDIYNT-TAPVFS--DPCREELMKALEPFMK 32 >gb|ABU86872.1| dehydrate responsive element-binding protein [Populus euphratica] Length = 375 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 465 MAAAIDIYNSKTAPVFSVMDPCREELMKALEPFMK 569 MAAAIDIYN+ TAPVFS DPCREELMKALEPFMK Sbjct: 1 MAAAIDIYNT-TAPVFS--DPCREELMKALEPFMK 32 >ref|XP_002307098.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|222856547|gb|EEE94094.1| hypothetical protein POPTR_0005s07900g [Populus trichocarpa] Length = 372 Score = 55.8 bits (133), Expect = 8e-06 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 465 MAAAIDIYNSKTAPVFSVMDPCREELMKALEPFMK 569 MAAAIDIYN+ T PVFS DPCREELMKALEPFMK Sbjct: 1 MAAAIDIYNT-TVPVFS--DPCREELMKALEPFMK 32