BLASTX nr result
ID: Jatropha_contig00033909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033909 (603 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_712836.1| questionable orf [Candida albicans SC5314] gi|6... 59 1e-06 >ref|XP_712836.1| questionable orf [Candida albicans SC5314] gi|68486626|ref|XP_712807.1| questionable orf [Candida albicans SC5314] gi|46434222|gb|EAK93638.1| questionable orf [Candida albicans SC5314] gi|46434252|gb|EAK93667.1| questionable orf [Candida albicans SC5314] Length = 190 Score = 58.5 bits (140), Expect = 1e-06 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 4/109 (3%) Frame = -2 Query: 425 WLLSFTLRRLLGWFMLW--KWLSSFTFIILHQNVSRVRIMRRLILFGWFLTMFLWRLLWS 252 W++ + +R + WFM W +W MR + GWF+ F+W + Sbjct: 16 WVVWWVVRWFMRWFMRWFMRWF-----------------MRWFV--GWFMRWFMWWFVGW 56 Query: 251 FMFW--RWFLSLTLRRLLGWFVF*RWLLSLTFRKLLGWFLTMFLWRLLW 111 FM W RWF+ +R +GWF+ RW + WF+ F+WR+ W Sbjct: 57 FMRWFMRWFMWRMMRWFVGWFM--RWFMR--------WFVRWFMWRMFW 95