BLASTX nr result
ID: Jatropha_contig00033824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033824 (389 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511834.1| protein with unknown function [Ricinus commu... 64 3e-08 gb|ERP53129.1| hypothetical protein POPTR_0014s07720g [Populus t... 58 1e-06 gb|EEE98433.2| adenosine-deaminase family protein [Populus trich... 58 1e-06 ref|XP_002320118.1| predicted protein [Populus trichocarpa] 58 1e-06 >ref|XP_002511834.1| protein with unknown function [Ricinus communis] gi|223549014|gb|EEF50503.1| protein with unknown function [Ricinus communis] Length = 443 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 348 ISLISLQNNAEAYSLNSRTFKGSPPFNNWPLKSIDLEAFCILR 220 IS L+N+AEAYS S+TFK SPPF+NWPLK +DLEAF ILR Sbjct: 368 ISYRELKNSAEAYSQTSKTFKRSPPFDNWPLKPMDLEAFSILR 410 >gb|ERP53129.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] Length = 418 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 363 CLTNIISLISLQNNAEAYSLNSRTFKGSPPFNNWPLKSIDLEAFCILR 220 C IS L+NNA+AYS S++FK S FNNWPLK +D EAF ILR Sbjct: 370 CPAKDISYRELKNNAQAYSSTSKSFKESAAFNNWPLKPLDSEAFSILR 417 >gb|EEE98433.2| adenosine-deaminase family protein [Populus trichocarpa] gi|550323732|gb|ERP53130.1| hypothetical protein POPTR_0014s07720g [Populus trichocarpa] Length = 404 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 363 CLTNIISLISLQNNAEAYSLNSRTFKGSPPFNNWPLKSIDLEAFCILR 220 C IS L+NNA+AYS S++FK S FNNWPLK +D EAF ILR Sbjct: 356 CPAKDISYRELKNNAQAYSSTSKSFKESAAFNNWPLKPLDSEAFSILR 403 >ref|XP_002320118.1| predicted protein [Populus trichocarpa] Length = 380 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 363 CLTNIISLISLQNNAEAYSLNSRTFKGSPPFNNWPLKSIDLEAFCILR 220 C IS L+NNA+AYS S++FK S FNNWPLK +D EAF ILR Sbjct: 332 CPAKDISYRELKNNAQAYSSTSKSFKESAAFNNWPLKPLDSEAFSILR 379