BLASTX nr result
ID: Jatropha_contig00033699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033699 (136 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525420.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 >ref|XP_002525420.1| conserved hypothetical protein [Ricinus communis] gi|223535233|gb|EEF36910.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 10 VIMPEKIKDPDLASKEADQDPISQVFFKKMRENEFVDMKI 129 +I+PE +KDPD A KEADQDPISQVFFKKM EN+FVDMK+ Sbjct: 95 IILPE-VKDPDKALKEADQDPISQVFFKKMTENKFVDMKM 133