BLASTX nr result
ID: Jatropha_contig00033544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033544 (250 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] 66 4e-09 gb|ADJ67170.1| hypothetical protein [Jatropha curcas] 66 5e-09 ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus comm... 58 1e-06 >gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] Length = 70 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/50 (68%), Positives = 35/50 (70%) Frame = +1 Query: 1 AAAALIEKENKHVNAIVLKEGTPVTRDFRCDXXXXXXXXXXXXXXXPIIT 150 AAAALIEKEN+HVNAIVLKEGTPVTRDFRCD PIIT Sbjct: 21 AAAALIEKENRHVNAIVLKEGTPVTRDFRCDRVWVWVNECGVVVRVPIIT 70 >gb|ADJ67170.1| hypothetical protein [Jatropha curcas] Length = 83 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 86 GATGSGFGLMNVVWSFEFLLLPRAMQFYSISK 181 GATGSGFGLMNV WSFEFLLLPRAMQFYSISK Sbjct: 52 GATGSGFGLMNVGWSFEFLLLPRAMQFYSISK 83 >ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539844|gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis] Length = 70 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 4 AAALIEKENKHVNAIVLKEGTPVTRDFRCD 93 AAA +EKENKHV+AIVLKEGTPVTRDFRC+ Sbjct: 22 AAATVEKENKHVHAIVLKEGTPVTRDFRCN 51