BLASTX nr result
ID: Jatropha_contig00033510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033510 (621 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY17281.1| Chaperone DnaJ-domain superfamily protein, putati... 64 1e-10 >gb|EOY17281.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma cacao] Length = 132 Score = 63.5 bits (153), Expect(2) = 1e-10 Identities = 43/99 (43%), Positives = 54/99 (54%), Gaps = 12/99 (12%) Frame = +1 Query: 115 VIRNGSGRLRATKQ*RRQ----RQDLGIAVLLSTPLKFPLAECRRTNVYAILGRSPFSSK 282 +I NGS RL +Q R+ L I ++ F T YA+LG +PF+SK Sbjct: 1 MIGNGSSRLGLRGANHQQLTSTRRGLRIPIICRCFPNF-------TTHYALLGLTPFASK 53 Query: 283 SDIKVVYKRLALKYH--------FPGRDKPFRKIKLAYE 375 SD+K YKRLALKYH PG+DK FR+IK AYE Sbjct: 54 SDVKQAYKRLALKYHPDVYKGEDVPGKDKAFREIKSAYE 92 Score = 28.9 bits (63), Expect(2) = 1e-10 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = +2 Query: 377 LMLKFEEQELQPAKDYDEWG-----MGFE 448 LM K+E ELQ KD+DE+ MGFE Sbjct: 94 LMQKYEADELQTEKDFDEYDDWEEWMGFE 122