BLASTX nr result
ID: Jatropha_contig00033499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033499 (362 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatrop... 79 6e-13 ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [... 74 2e-11 gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Maniho... 71 2e-10 gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Maniho... 71 2e-10 gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] 71 2e-10 gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus cl... 67 2e-09 gb|ABL67651.1| putative auxin-repressed/dormancy-associated prot... 67 2e-09 ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis ... 67 2e-09 ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis ... 67 2e-09 ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 66 4e-09 ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 66 4e-09 ref|XP_004234112.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 66 4e-09 gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] 66 4e-09 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 66 4e-09 gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] 66 5e-09 ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Caps... 65 7e-09 dbj|BAG50402.1| dormancy and auxin associated protein [Cardamine... 65 7e-09 gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Ambore... 65 9e-09 ref|XP_004134697.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 65 1e-08 ref|XP_002881308.1| dormancy/auxin associated family protein [Ar... 65 1e-08 >gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatropha curcas] Length = 120 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR Sbjct: 86 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 120 >ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] gi|223549345|gb|EEF50833.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] Length = 118 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+G+GAQLFDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 84 ATRGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 118 >gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Manihot esculenta] Length = 68 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATKGLGAQLFDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 35 ATKGLGAQLFDKPQ-PNSPTVYDWLYSGETRSKHR 68 >gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Manihot esculenta] Length = 117 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATKGLGAQLFDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 84 ATKGLGAQLFDKPQ-PNSPTVYDWLYSGETRSKHR 117 >gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] Length = 120 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+GLG ++FDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 86 ATRGLGTEMFDKPSQPNSPTVYDWLYSGETRSKHR 120 >gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus clementina] Length = 122 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 102 AT+G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 87 ATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >gb|ABL67651.1| putative auxin-repressed/dormancy-associated protein [Citrus hybrid cultivar] Length = 122 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 102 AT+G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 87 ATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|20198309|gb|AAC69134.2| putative auxin-regulated protein [Arabidopsis thaliana] gi|21553815|gb|AAM62908.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330253797|gb|AEC08891.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 106 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 72 ATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 106 >ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|13605730|gb|AAK32858.1|AF361846_1 At2g33830/T1B8.13 [Arabidopsis thaliana] gi|11127601|dbj|BAB17679.1| Dormancy-associated protein homolog [Arabidopsis thaliana] gi|17978893|gb|AAL47416.1| At2g33830/T1B8.13 [Arabidopsis thaliana] gi|330253798|gb|AEC08892.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 108 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 74 ATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 108 >ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Solanum tuberosum] Length = 123 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 89 ATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 123 >ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Solanum tuberosum] Length = 129 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 95 ATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 129 >ref|XP_004234112.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Solanum lycopersicum] Length = 130 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 96 ATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 130 >gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] Length = 127 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 93 ATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 127 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATKGLG+ LFDKP+ PNSPTVYDWLYSG+TRSKHR Sbjct: 86 ATKGLGSALFDKPE-PNSPTVYDWLYSGETRSKHR 119 >gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] Length = 118 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATKG+G+ +FDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 85 ATKGIGSDVFDKPQ-PNSPTVYDWLYSGETRSKHR 118 >ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] gi|482563992|gb|EOA28182.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] Length = 108 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+G+G LFDKP PNSPTVYDWLYS DTRS+HR Sbjct: 74 ATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSQHR 108 >dbj|BAG50402.1| dormancy and auxin associated protein [Cardamine sp. SIM-2007] Length = 57 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 AT+G+G LFDKP PNSPT YDWLYS DTRSKHR Sbjct: 23 ATRGMGTNLFDKPSHPNSPTTYDWLYSDDTRSKHR 57 >gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Amborella trichopoda] Length = 120 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GA++FDKPQ PNSPTVYDWLYSGDTRS+HR Sbjct: 87 ATKTIGAEVFDKPQ-PNSPTVYDWLYSGDTRSRHR 120 >ref|XP_004134697.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Cucumis sativus] gi|449479282|ref|XP_004155558.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Cucumis sativus] Length = 120 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 105 ATK +GAQ+FDKPQ PNSPTVYDWLYSGDT+S+HR Sbjct: 87 ATKTIGAQVFDKPQ-PNSPTVYDWLYSGDTKSQHR 120 >ref|XP_002881308.1| dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] gi|297327147|gb|EFH57567.1| dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +1 Query: 1 ATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 102 ATKG G LFDKP PNSPTVYDWLYS DTRSKH Sbjct: 74 ATKGRGTNLFDKPSHPNSPTVYDWLYSDDTRSKH 107