BLASTX nr result
ID: Jatropha_contig00033365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033365 (644 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530584.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002530584.1| conserved hypothetical protein [Ricinus communis] gi|223529883|gb|EEF31814.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 157 DAGVMKLIFFGSLAAGIIVKLLPYEYTDRGDPVPTGIFKGLP 282 D GVMK I FG +A G++VKLLPYEY + +PVPT IFK +P Sbjct: 26 DDGVMKFIMFGCVAIGVVVKLLPYEYREGINPVPTVIFKEIP 67