BLASTX nr result
ID: Jatropha_contig00033348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00033348 (613 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517157.1| chloroplast-targeted copper chaperone, putat... 62 9e-08 >ref|XP_002517157.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223543792|gb|EEF45320.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 526 Score = 62.4 bits (150), Expect = 9e-08 Identities = 43/96 (44%), Positives = 47/96 (48%), Gaps = 2/96 (2%) Frame = +1 Query: 238 ALQDLN-KLAQFKDMKMG-NSNPNPNQKAVKFAPGPLXXXXXXXXXXXXXXXXXXXXXXX 411 A+QDLN K+AQ KDMKM N+N N NQKAVKFAP P Sbjct: 159 AMQDLNNKMAQLKDMKMPPNNNQNQNQKAVKFAPQP-EDEDLSDDDYDDDYDDDDFDDED 217 Query: 412 XXXXXXPQHPLNKMKPVXXXXXXXXXXLHPQLMNAQ 519 PQHP NKMKPV +HPQLMN Q Sbjct: 218 FDELDDPQHPFNKMKPV-MPNGNMMNGMHPQLMNVQ 252