BLASTX nr result
ID: Jatropha_contig00032864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00032864 (633 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP58250.1| hypothetical protein POPTR_0007s06170g, partial [... 50 1e-07 >gb|ERP58250.1| hypothetical protein POPTR_0007s06170g, partial [Populus trichocarpa] Length = 70 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +1 Query: 1 SLCLYDHDRTVQNERSIPRLFLEVLELQTSRSAIVLLRS*FLVSIICF 144 SLCLYD D TVQN S RLF VL+ +T RSA+ +LRS FLV F Sbjct: 11 SLCLYDQDPTVQNGWSSKRLFFPVLDPETFRSALSVLRSSFLVFYFSF 58 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +3 Query: 123 SGLYYLFSFFKARKWRLTTAQ 185 S L + FSFF ARKWRL T Q Sbjct: 50 SFLVFYFSFFDARKWRLRTVQ 70