BLASTX nr result
ID: Jatropha_contig00032807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00032807 (623 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514260.1| Galactose oxidase precursor, putative [Ricin... 76 6e-12 dbj|BAL41453.1| glyoxal oxidase 4 [Linum grandiflorum] 70 6e-10 dbj|BAL41451.1| glyoxal oxidase 2 [Linum grandiflorum] 68 2e-09 ref|XP_002331167.1| predicted protein [Populus trichocarpa] gi|5... 66 6e-09 dbj|BAL41452.1| glyoxal oxidase 3 [Linum grandiflorum] 66 8e-09 dbj|BAL41448.1| glyoxal oxidase 1 [Linum grandiflorum] 65 1e-08 dbj|BAL41454.1| glyoxal oxidase 5 [Linum grandiflorum] 65 1e-08 gb|EEF02996.2| hypothetical protein POPTR_0018s09110g [Populus t... 64 3e-08 >ref|XP_002514260.1| Galactose oxidase precursor, putative [Ricinus communis] gi|223546716|gb|EEF48214.1| Galactose oxidase precursor, putative [Ricinus communis] Length = 613 Score = 76.3 bits (186), Expect = 6e-12 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = +1 Query: 226 WLKKDAYKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGTP 357 W + +AYK FN++ VLGPHE+FGDPFGNP D+K+ +IPDDFGTP Sbjct: 23 WKEPNAYKIFNQKHVLGPHELFGDPFGNPFDYKNSRIPDDFGTP 66 >dbj|BAL41453.1| glyoxal oxidase 4 [Linum grandiflorum] Length = 641 Score = 69.7 bits (169), Expect = 6e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 256 NEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGTP 357 NE+KVLGPHE FGDPFGNP D+KDKK+PDD GTP Sbjct: 54 NEKKVLGPHEKFGDPFGNPQDYKDKKLPDDIGTP 87 >dbj|BAL41451.1| glyoxal oxidase 2 [Linum grandiflorum] Length = 693 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 244 YKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGTP 357 ++T NEEKVLGPHE+FG+PFGNP+DF KKI DD GTP Sbjct: 57 FETLNEEKVLGPHELFGNPFGNPDDFAKKKIADDVGTP 94 >ref|XP_002331167.1| predicted protein [Populus trichocarpa] gi|550336479|gb|ERP59523.1| hypothetical protein POPTR_0006s16390g [Populus trichocarpa] Length = 609 Score = 66.2 bits (160), Expect = 6e-09 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 226 WLKKDAYKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGT 354 WL+ DAY N++K+LGPHE+F DPFG+ D+K KKI DDFGT Sbjct: 23 WLRPDAYVLLNKKKILGPHELFNDPFGDALDYKRKKITDDFGT 65 >dbj|BAL41452.1| glyoxal oxidase 3 [Linum grandiflorum] Length = 668 Score = 65.9 bits (159), Expect = 8e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 244 YKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGTP 357 + N+E V+G HE+FGDPFGNPNDFK +KIPDD GTP Sbjct: 37 FSLLNKEHVMGKHELFGDPFGNPNDFKSRKIPDDVGTP 74 >dbj|BAL41448.1| glyoxal oxidase 1 [Linum grandiflorum] Length = 643 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 256 NEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGT 354 NE+K LGPHE FGDPFGNP D+K+KK+PDDFGT Sbjct: 60 NEKKPLGPHEKFGDPFGNPQDYKEKKLPDDFGT 92 >dbj|BAL41454.1| glyoxal oxidase 5 [Linum grandiflorum] Length = 645 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +1 Query: 229 LKKDAYKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGTP 357 +K + N E VLGPHE FG+PFGNPNDFK +KIP+D GTP Sbjct: 29 MKPGDFGLMNREHVLGPHEQFGNPFGNPNDFKSRKIPNDVGTP 71 >gb|EEF02996.2| hypothetical protein POPTR_0018s09110g [Populus trichocarpa] Length = 608 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 226 WLKKDAYKTFNEEKVLGPHEMFGDPFGNPNDFKDKKIPDDFGT 354 WL+ DAY+ FN++K+LGPHE+F +PFG+ D+ KKI +DFGT Sbjct: 23 WLRPDAYEFFNKKKILGPHELFNNPFGDAQDYLRKKIDNDFGT 65