BLASTX nr result
ID: Jatropha_contig00032803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00032803 (332 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX99431.1| Ubiquitin-conjugating enzyme family protein, puta... 82 5e-14 gb|ABK95695.1| unknown [Populus trichocarpa] gi|550325762|gb|ERP... 77 2e-12 ref|XP_002517911.1| ubiquitin conjugating enzyme, putative [Rici... 67 3e-09 gb|EOX99432.1| Ubiquitin-conjugating enzyme family protein, puta... 57 2e-06 >gb|EOX99431.1| Ubiquitin-conjugating enzyme family protein, putative isoform 1 [Theobroma cacao] Length = 516 Score = 82.4 bits (202), Expect = 5e-14 Identities = 43/96 (44%), Positives = 63/96 (65%) Frame = +2 Query: 44 MDLHMEDQASISKKLKHSEVVLCDVMDVESNLDPSEVLVGHENVDTYSKGKSKVGYSASR 223 MDL + D+ SISK+LK ++++LCD MD+ DP+ VL+G E SKGKSK+ Y Sbjct: 1 MDLRV-DETSISKRLKQTQILLCDAMDIGQVEDPTTVLIGSEKAGVDSKGKSKICYDKKW 59 Query: 224 PHNIKDTSSCDPGISTSIAGTVDIIDYLKISTTGSM 331 ++KD S+ + G S S+AG+ D + LK ST+GS+ Sbjct: 60 EDHVKDASASEQGNSVSVAGSEDSNNPLKSSTSGSI 95 >gb|ABK95695.1| unknown [Populus trichocarpa] gi|550325762|gb|ERP54283.1| hypothetical protein POPTR_0013s13440g [Populus trichocarpa] gi|550325763|gb|ERP54284.1| hypothetical protein POPTR_0013s13440g [Populus trichocarpa] Length = 526 Score = 77.0 bits (188), Expect = 2e-12 Identities = 48/98 (48%), Positives = 62/98 (63%), Gaps = 3/98 (3%) Frame = +2 Query: 44 MDLHMED---QASISKKLKHSEVVLCDVMDVESNLDPSEVLVGHENVDTYSKGKSKVGYS 214 MDL M D +ISKKLK SEVVLCDVMD ++ EVL+ H D +KGKSK + Sbjct: 1 MDLDMADGNQDVAISKKLKQSEVVLCDVMDAQA-----EVLICHGKADMGTKGKSKSVHD 55 Query: 215 ASRPHNIKDTSSCDPGISTSIAGTVDIIDYLKISTTGS 328 + +IK+ SS D G TS+AG+VD +L+ ST+GS Sbjct: 56 DAWQQDIKNASSSDLGNYTSVAGSVDSAYHLRGSTSGS 93 >ref|XP_002517911.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223542893|gb|EEF44429.1| ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 521 Score = 66.6 bits (161), Expect = 3e-09 Identities = 40/96 (41%), Positives = 56/96 (58%) Frame = +2 Query: 44 MDLHMEDQASISKKLKHSEVVLCDVMDVESNLDPSEVLVGHENVDTYSKGKSKVGYSASR 223 M++ ++DQ SIS L E VL D MDVE ++D E DT SKGK+KVG + Sbjct: 1 MNIDIDDQVSISNNLNQKEAVLFDAMDVERDVD--------EKADTSSKGKTKVGDDVTW 52 Query: 224 PHNIKDTSSCDPGISTSIAGTVDIIDYLKISTTGSM 331 H+ D G++ S+AG+VD D+ K ST+GS+ Sbjct: 53 QHH------QDSGLNASVAGSVDSNDHPKSSTSGSI 82 >gb|EOX99432.1| Ubiquitin-conjugating enzyme family protein, putative isoform 2 [Theobroma cacao] Length = 492 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/71 (42%), Positives = 43/71 (60%) Frame = +2 Query: 119 MDVESNLDPSEVLVGHENVDTYSKGKSKVGYSASRPHNIKDTSSCDPGISTSIAGTVDII 298 MD+ DP+ VL+G E SKGKSK+ Y ++KD S+ + G S S+AG+ D Sbjct: 1 MDIGQVEDPTTVLIGSEKAGVDSKGKSKICYDKKWEDHVKDASASEQGNSVSVAGSEDSN 60 Query: 299 DYLKISTTGSM 331 + LK ST+GS+ Sbjct: 61 NPLKSSTSGSI 71