BLASTX nr result
ID: Jatropha_contig00032113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00032113 (436 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528248.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002528248.1| conserved hypothetical protein [Ricinus communis] gi|223532334|gb|EEF34133.1| conserved hypothetical protein [Ricinus communis] Length = 107 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = +2 Query: 53 KKVSTAIMVMMLVMVASMEVGEAWEWKWEWPFQSIYKQ-HEKCYSKCYKECMG--FQKIA 223 K +T I++ MLVM +S+EVGE+ W WPF+S + CY CY CM + + Sbjct: 6 KVTTTLILISMLVMFSSLEVGES--WSLPWPFKSFTPALNIACYDTCYNLCMSPPYNAGS 63 Query: 224 TAKLCKGRCTTVC 262 T CK +CT C Sbjct: 64 TLNSCKDQCTPAC 76