BLASTX nr result
ID: Jatropha_contig00032020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00032020 (315 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE90198.2| hypothetical protein POPTR_0007s01070g [Populus t... 57 2e-06 ref|XP_002309748.1| predicted protein [Populus trichocarpa] 57 2e-06 ref|XP_002863600.1| predicted protein [Arabidopsis lyrata subsp.... 55 7e-06 ref|NP_001078707.1| protease inhibitor/seed storage/LTP family p... 55 7e-06 ref|XP_006281881.1| hypothetical protein CARUB_v10028079mg [Caps... 55 9e-06 >gb|EEE90198.2| hypothetical protein POPTR_0007s01070g [Populus trichocarpa] Length = 119 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 3 IGPRWICRCIESISKATEDRFNATRIDQLPLLCDTYLSFPISENMDC 143 +GPR IC CIE I + + A RI LP+ C+T+LSFPISE MDC Sbjct: 67 MGPRAICECIEIIIRTIPMKLRADRISDLPVRCNTHLSFPISEYMDC 113 >ref|XP_002309748.1| predicted protein [Populus trichocarpa] Length = 117 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 3 IGPRWICRCIESISKATEDRFNATRIDQLPLLCDTYLSFPISENMDC 143 +GPR IC CIE I + + A RI LP+ C+T+LSFPISE MDC Sbjct: 67 MGPRAICECIEIIIRTIPMKLRADRISDLPVRCNTHLSFPISEYMDC 113 >ref|XP_002863600.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309435|gb|EFH39859.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 126 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 9 PRWICRCIESISKATEDRFNATRIDQLPLLCDTYLSFPISENMDC 143 PR +C C+E +++ A +I QLPLLC+T+LSFPIS +MDC Sbjct: 79 PRLLCNCVEMMTRGYTPPILADKIQQLPLLCNTHLSFPISSSMDC 123 >ref|NP_001078707.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] gi|218527937|sp|A8MQA2.1|NLTPD_ARATH RecName: Full=Non-specific lipid-transfer protein 13; Short=LTP 13; Flags: Precursor gi|332007700|gb|AED95083.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] Length = 126 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 9 PRWICRCIESISKATEDRFNATRIDQLPLLCDTYLSFPISENMDC 143 PR +C C+E +++ A +I QLPLLC+T+LSFPIS +MDC Sbjct: 79 PRLLCNCVEMMTRGYTPPMLADKIQQLPLLCNTHLSFPISSSMDC 123 >ref|XP_006281881.1| hypothetical protein CARUB_v10028079mg [Capsella rubella] gi|482550585|gb|EOA14779.1| hypothetical protein CARUB_v10028079mg [Capsella rubella] Length = 125 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 9 PRWICRCIESISKATEDRFNATRIDQLPLLCDTYLSFPISENMDC 143 PR +C C+E +++ A +I QLPLLC+T+LSFPIS +MDC Sbjct: 79 PRLLCNCVEIMTRGYTPPMLADKIQQLPLLCNTHLSFPISSSMDC 123