BLASTX nr result
ID: Jatropha_contig00031287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00031287 (256 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516405.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002322330.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 >ref|XP_002516405.1| conserved hypothetical protein [Ricinus communis] gi|223544440|gb|EEF45960.1| conserved hypothetical protein [Ricinus communis] Length = 275 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 IVFVVPSALFIMNLMWFAKIIKGLRKTLAKRQ 97 +VFVVPSALFIMNLMWFAKI KGL KTLAKRQ Sbjct: 244 VVFVVPSALFIMNLMWFAKIFKGLMKTLAKRQ 275 >ref|XP_002322330.1| predicted protein [Populus trichocarpa] gi|222869326|gb|EEF06457.1| hypothetical protein POPTR_0015s12490g [Populus trichocarpa] gi|550322573|gb|ERP52394.1| hypothetical protein POPTR_0015s12490g [Populus trichocarpa] Length = 275 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 IVFVVPSALFIMNLMWFAKIIKGLRKTLAKRQ 97 +VF+VP+ LFIMNLMWF KIIKGL+KTLAKRQ Sbjct: 244 LVFLVPAVLFIMNLMWFGKIIKGLKKTLAKRQ 275