BLASTX nr result
ID: Jatropha_contig00031203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00031203 (516 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511988.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 >ref|XP_002511988.1| conserved hypothetical protein [Ricinus communis] gi|223549168|gb|EEF50657.1| conserved hypothetical protein [Ricinus communis] Length = 216 Score = 74.3 bits (181), Expect = 1e-11 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 1/76 (1%) Frame = -1 Query: 441 LLYAVGTRTGC-GHIKQTGCSLIVVAAQFGRSDPPNGFNKLVLSAPIGLGKQLQPIYGKK 265 LL AV R GC I QTGC+ + V+ QF ++ GF KL L+APIGLGKQL+PIYG K Sbjct: 50 LLDAVRLRVGCKDRINQTGCTPVYVSLQF-QACIQTGFKKLSLTAPIGLGKQLRPIYGSK 108 Query: 264 HFNRKQFAFITCYAAM 217 + NRK ITC+AA+ Sbjct: 109 YSNRKLSDSITCFAAV 124