BLASTX nr result
ID: Jatropha_contig00031047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00031047 (317 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67170.1| hypothetical protein [Jatropha curcas] 66 5e-09 gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] 59 8e-07 >gb|ADJ67170.1| hypothetical protein [Jatropha curcas] Length = 83 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 114 GATGSGFGLMNVVWSFEFLLLPRAMQFYSISK 209 GATGSGFGLMNV WSFEFLLLPRAMQFYSISK Sbjct: 52 GATGSGFGLMNVGWSFEFLLLPRAMQFYSISK 83 >gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] Length = 70 Score = 58.5 bits (140), Expect = 8e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +2 Query: 44 IEKENKHVNAIVLKEGTPVTRDFRCDXXXXXXXXXXXXXXXPIIT 178 IEKEN+HVNAIVLKEGTPVTRDFRCD PIIT Sbjct: 26 IEKENRHVNAIVLKEGTPVTRDFRCDRVWVWVNECGVVVRVPIIT 70