BLASTX nr result
ID: Jatropha_contig00030545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00030545 (429 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 115 6e-24 gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus cl... 108 9e-22 gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [... 107 1e-21 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 106 3e-21 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 104 1e-20 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 102 4e-20 gb|AFP99877.1| plasma membrane protein Am244 [Avicennia marina] ... 102 4e-20 ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatu... 102 5e-20 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 102 5e-20 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [C... 102 7e-20 gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus pe... 102 7e-20 ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus ... 102 7e-20 gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus... 101 1e-19 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 101 1e-19 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 100 1e-19 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 100 1e-19 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [F... 100 1e-19 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 100 1e-19 gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes ... 100 1e-19 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 100 2e-19 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 115 bits (288), Expect = 6e-24 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 MPSEGTATCID +LAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 108 bits (269), Expect = 9e-22 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M EGTATCID +LA+ILPPLGVFLKFGCK EFWICLLLTI GYIPGIIYAVYAITK Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 107 bits (268), Expect = 1e-21 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = +3 Query: 63 ERKMPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 + KM TATC+D +LAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 44 QSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 103 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 106 bits (264), Expect = 3e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 84 GTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 GTATC+D +LAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 2 GTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 104 bits (259), Expect = 1e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = +3 Query: 84 GTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 GTATC+D +LA+ILPPLGVFL+FGCK EFWICLLLTILGYIPGIIYA+YAITK Sbjct: 2 GTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 102 bits (255), Expect = 4e-20 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 78 SEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 SEGTA CID ++A+ILPPLGVFLKFGCK EFWICLLLT LGY+PGIIYA+YAITK Sbjct: 2 SEGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >gb|AFP99877.1| plasma membrane protein Am244 [Avicennia marina] gi|476002154|gb|AGI62243.1| plasma membrane protein [Avicennia marina] Length = 57 Score = 102 bits (255), Expect = 4e-20 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = +3 Query: 78 SEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 +EGTATCID V+A++LPPLGVFLK+GCK EFWICLLLTILGYIPGIIYAV+AIT+ Sbjct: 2 AEGTATCIDIVVAILLPPLGVFLKYGCKGEFWICLLLTILGYIPGIIYAVWAITR 56 >ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 102 bits (254), Expect = 5e-20 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 84 GTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 GTATCID +LA+ILPPLGVFLKFGC EFWICL+LTILGY+PGIIYA+YAITK Sbjct: 2 GTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 102 bits (254), Expect = 5e-20 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = +3 Query: 81 EGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 EGTA C+D +LA+ILPP+GVFLKFGC AEFWICLLLTILGY+PGI+YA+YAITK Sbjct: 3 EGTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTILGYLPGIVYAIYAITK 56 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 54 Score = 102 bits (253), Expect = 7e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 84 GTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 GTATC+D +LA+ILPPLGVFLKFGC EFWICL+LTILGY+PGIIYA+YAITK Sbjct: 2 GTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 102 bits (253), Expect = 7e-20 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 MPSEGTA ID ++A++LPPLGVFLKFGC EFWICLLLTI GYIPGIIYAVYAITK Sbjct: 1 MPSEGTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 57 Score = 102 bits (253), Expect = 7e-20 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M EGTATCID +LA+ILPPLGVFLKFGC EFWICLLLT GY+PGIIYA+YAITK Sbjct: 1 MADEGTATCIDILLAIILPPLGVFLKFGCGVEFWICLLLTFFGYLPGIIYAIYAITK 57 >gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris] Length = 57 Score = 101 bits (251), Expect = 1e-19 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M TATCID +LA+ILPPLGVFLK GCK EFWICLLLTILGYIPGIIYAVYAITK Sbjct: 1 MADGSTATCIDILLAIILPPLGVFLKHGCKVEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 101 bits (251), Expect = 1e-19 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M +GTA CID +LA+ILPPLGVFLKFGC+ EFWICLLLT+ GYIPGIIYAVYAITK Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 100 bits (250), Expect = 1e-19 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +3 Query: 81 EGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 EGTA C+D ++A+ILPPLGVFLKFGCK EFWICLLLT LGY+PGIIYA+YAITK Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 100 bits (250), Expect = 1e-19 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +3 Query: 81 EGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 EGTA C+D ++A+ILPPLGVFLKFGCK EFW+CLLLT LGY+PGIIYA+YAITK Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. vesca] Length = 57 Score = 100 bits (250), Expect = 1e-19 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 MPSEGTA ID ++A++LPPLGVFLKFGC EFWICLLLTI GYIPGIIYA+Y ITK Sbjct: 1 MPSEGTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 100 bits (250), Expect = 1e-19 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M + TATCID +LA+ILPPLGVFLK+GCK EFWICL+LT+ GYIPGIIYAVYAITK Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica] Length = 57 Score = 100 bits (250), Expect = 1e-19 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +3 Query: 72 MPSEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 M EGTA+CID ++A+ILPPLGVFLKFGC EFWICLLLT LGY+PGIIYAVYAITK Sbjct: 1 MADEGTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYLPGIIYAVYAITK 57 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 100 bits (249), Expect = 2e-19 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = +3 Query: 78 SEGTATCIDGVLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 242 ++G ATCID +LA+ILPPLGVFLK+GCK EFWICL+LT+ GYIPGIIYAVYAITK Sbjct: 2 ADGAATCIDILLAIILPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAVYAITK 56