BLASTX nr result
ID: Jatropha_contig00030288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00030288 (628 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP53234.1| hypothetical protein POPTR_0014s11590g [Populus t... 56 9e-06 ref|XP_002301511.1| predicted protein [Populus trichocarpa] gi|2... 56 9e-06 >gb|ERP53234.1| hypothetical protein POPTR_0014s11590g [Populus trichocarpa] Length = 139 Score = 55.8 bits (133), Expect = 9e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 538 RQAASSGSDSDPRYANIVDERKRKRMISNR 627 RQAASSGSDSDPRYAN VDERKRKRMISNR Sbjct: 4 RQAASSGSDSDPRYAN-VDERKRKRMISNR 32 >ref|XP_002301511.1| predicted protein [Populus trichocarpa] gi|222843237|gb|EEE80784.1| bZIP transcription factor family protein [Populus trichocarpa] Length = 144 Score = 55.8 bits (133), Expect = 9e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 538 RQAASSGSDSDPRYANIVDERKRKRMISNR 627 RQAASSGSDSDPRYAN VDERKRKRMISNR Sbjct: 4 RQAASSGSDSDPRYAN-VDERKRKRMISNR 32