BLASTX nr result
ID: Jatropha_contig00030135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00030135 (724 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56186.1| hypothetical protein [Jatropha curcas] 69 1e-09 gb|ESR43004.1| hypothetical protein CICLE_v10013503mg [Citrus cl... 60 9e-07 >gb|ADU56186.1| hypothetical protein [Jatropha curcas] Length = 66 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +3 Query: 543 GYPTKDGDTQNQVPVETKSRGDGFWKGW*AKSCC 644 GYPTKDGDTQNQVPVETKSRGDGFWKG A CC Sbjct: 25 GYPTKDGDTQNQVPVETKSRGDGFWKGCCAALCC 58 >gb|ESR43004.1| hypothetical protein CICLE_v10013503mg [Citrus clementina] Length = 113 Score = 59.7 bits (143), Expect = 9e-07 Identities = 37/76 (48%), Positives = 41/76 (53%), Gaps = 16/76 (21%) Frame = +3 Query: 543 GYPTKDGD---TQNQVPVETKSRGDGFWKGW*AKSCC--------SFRFIFPIFANV--- 680 GYPTKDGD QN PVETKSRGDGFWKGW A C S+ I+ + + Sbjct: 32 GYPTKDGDHGYAQN-APVETKSRGDGFWKGWYAIFMCFTSPYVNYSYICIYTRTSIICVV 90 Query: 681 --LFSFWYSCAALCCC 722 L SCA LCCC Sbjct: 91 TDLVGLICSCAGLCCC 106