BLASTX nr result
ID: Jatropha_contig00029783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00029783 (563 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53103.1| JHL20J20.10 [Jatropha curcas] 57 3e-06 >dbj|BAJ53103.1| JHL20J20.10 [Jatropha curcas] Length = 276 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/61 (57%), Positives = 41/61 (67%) Frame = +2 Query: 377 EDLVSTIKKTMKLEAHLRKAQAERERERVMGKTRK*SNGNISKQHLEQVRERLVLENKIG 556 EDL KKTM+LEA LRKAQAERE + + + ++S LEQVRERLVLEN IG Sbjct: 143 EDLAQATKKTMELEACLRKAQAERETWQRQARENEAMVIDLSNT-LEQVRERLVLENNIG 201 Query: 557 Q 559 Q Sbjct: 202 Q 202