BLASTX nr result
ID: Jatropha_contig00029774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00029774 (418 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya] 123 3e-26 ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricin... 122 5e-26 sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase... 121 1e-25 gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nig... 120 1e-25 gb|AFR41233.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41232.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 gb|AFR41231.1| phenylalanine ammonia-lyase, partial [Populus nigra] 120 1e-25 ref|XP_004307376.1| PREDICTED: phenylalanine ammonia-lyase 1-lik... 119 4e-25 gb|ADQ39192.1| phenylalanine ammonia lyase 6 [Fragaria x ananassa] 119 4e-25 gb|AAY82486.1| phenylalanine ammonia-lyase [Ulmus pumila] 119 4e-25 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus t... 119 5e-25 gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] 119 5e-25 gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa] 119 5e-25 sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase... 119 5e-25 gb|AFR41235.1| phenylalanine ammonia-lyase, partial [Populus nigra] 119 5e-25 gb|AFR41221.1| phenylalanine ammonia-lyase, partial [Populus fre... 119 5e-25 >gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya] Length = 268 Score = 123 bits (308), Expect = 3e-26 Identities = 55/62 (88%), Positives = 60/62 (96%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L TGLLTGEKVRSPGE+FDKVF A+CAGK+IDPLL+CLKEWNGAPLP Sbjct: 207 CRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFSAMCAGKMIDPLLDCLKEWNGAPLP 266 Query: 182 IS 187 IS Sbjct: 267 IS 268 >ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis] gi|223528682|gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis] Length = 719 Score = 122 bits (306), Expect = 5e-26 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L TGLLTGEK+RSPGE+FDKVF A+CAGKLIDP+LECLKEWNGAPLP Sbjct: 658 CRSYPLYKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLP 717 Query: 182 I 184 I Sbjct: 718 I 718 >sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 gi|485810|dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata] Length = 682 Score = 121 bits (303), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGEDFDKVF AICAGKL+DPLLECLKEWNGAPLP Sbjct: 621 CRSYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLP 680 Query: 182 I 184 I Sbjct: 681 I 681 >gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 86 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 25 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 84 Query: 182 I 184 I Sbjct: 85 I 85 >gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 84 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 23 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 82 Query: 182 I 184 I Sbjct: 83 I 83 >gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 117 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 56 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 115 Query: 182 I 184 I Sbjct: 116 I 116 >gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 91 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 30 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 89 Query: 182 I 184 I Sbjct: 90 I 90 >gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327733|gb|AFR41240.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327735|gb|AFR41241.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327737|gb|AFR41242.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 59 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 118 Query: 182 I 184 I Sbjct: 119 I 119 >gb|AFR41233.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 81 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 20 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 79 Query: 182 I 184 I Sbjct: 80 I 80 >gb|AFR41232.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 59 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 118 Query: 182 I 184 I Sbjct: 119 I 119 >gb|AFR41231.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 120 bits (302), Expect = 1e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 19 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLP 78 Query: 182 I 184 I Sbjct: 79 I 79 >ref|XP_004307376.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Fragaria vesca subsp. vesca] Length = 718 Score = 119 bits (298), Expect = 4e-25 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLY+FVRE+L T LLTGEK+RSPGE+ DKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 657 CRSYPLYRFVREELGTSLLTGEKIRSPGEECDKVFNAICAGKLIDPLLECLKEWNGAPLP 716 Query: 182 IS 187 IS Sbjct: 717 IS 718 >gb|ADQ39192.1| phenylalanine ammonia lyase 6 [Fragaria x ananassa] Length = 720 Score = 119 bits (298), Expect = 4e-25 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLY+FVRE+L T LLTGEK+RSPGE+ DKVF AICAGKLIDPLLECLKEWNGAPLP Sbjct: 659 CRSYPLYRFVREELGTSLLTGEKIRSPGEECDKVFNAICAGKLIDPLLECLKEWNGAPLP 718 Query: 182 IS 187 IS Sbjct: 719 IS 720 >gb|AAY82486.1| phenylalanine ammonia-lyase [Ulmus pumila] Length = 622 Score = 119 bits (298), Expect = 4e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRS+PLYKFVRE+L TGLLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEW+GAPLP Sbjct: 561 CRSFPLYKFVREELRTGLLTGEKVKSPGEEFDKVFPAICAGKLIDPLLECLKEWDGAPLP 620 Query: 182 I 184 I Sbjct: 621 I 621 >gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa] Length = 707 Score = 119 bits (297), Expect = 5e-25 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEW+GAPLP Sbjct: 646 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLP 705 Query: 182 I 184 I Sbjct: 706 I 706 >gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] Length = 715 Score = 119 bits (297), Expect = 5e-25 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE++ TGLLTGEKV+SPGE+FDKVF AIC GK+IDP+LECLKEWNGAPLP Sbjct: 654 CRSYPLYKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLP 713 Query: 182 I 184 I Sbjct: 714 I 714 >gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa] Length = 711 Score = 119 bits (297), Expect = 5e-25 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEW+GAPLP Sbjct: 650 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLP 709 Query: 182 I 184 I Sbjct: 710 I 710 >sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B gi|2118317|pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen x large-toothed aspen gi|1109641|dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata] Length = 710 Score = 119 bits (297), Expect = 5e-25 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEW+GAPLP Sbjct: 649 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLP 708 Query: 182 I 184 I Sbjct: 709 I 709 >gb|AFR41235.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 119 bits (297), Expect = 5e-25 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDK F AICAGKLIDPLLECLKEWNGAPLP Sbjct: 19 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKXFTAICAGKLIDPLLECLKEWNGAPLP 78 Query: 182 I 184 I Sbjct: 79 I 79 >gb|AFR41221.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327697|gb|AFR41222.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327699|gb|AFR41223.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327701|gb|AFR41224.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327703|gb|AFR41225.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327705|gb|AFR41226.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327709|gb|AFR41228.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327711|gb|AFR41229.1| phenylalanine ammonia-lyase, partial [Populus fremontii] gi|403327713|gb|AFR41230.1| phenylalanine ammonia-lyase, partial [Populus fremontii] Length = 118 Score = 119 bits (297), Expect = 5e-25 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +2 Query: 2 CRSYPLYKFVREDLSTGLLTGEKVRSPGEDFDKVFEAICAGKLIDPLLECLKEWNGAPLP 181 CRSYPLYKFVRE+L T LLTGEKV+SPGE+FDKVF AICAGKLIDPLLECLKEW+GAPLP Sbjct: 57 CRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLP 116 Query: 182 I 184 I Sbjct: 117 I 117