BLASTX nr result
ID: Jatropha_contig00029624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00029624 (626 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_001814932.1| hypothetical protein, partial [Staphylococcu... 59 1e-06 >ref|WP_001814932.1| hypothetical protein, partial [Staphylococcus aureus] gi|375014368|gb|EHS08056.1| hypothetical protein IS3_0975, partial [Staphylococcus aureus subsp. aureus IS-3] Length = 204 Score = 58.5 bits (140), Expect = 1e-06 Identities = 51/168 (30%), Positives = 72/168 (42%), Gaps = 4/168 (2%) Frame = +1 Query: 118 MNLNHPMRAHTGLPRSHLQNKNHLMSLLGVKAINHLLNMRSHKSHLEERVKSH----HRS 285 +N +H + + L SH N NH +SL +N LN+ + R SH +R Sbjct: 31 LNRSHYLILNRCLSLSHYLNLNHCLSLSHYLILNRYLNLNHSLNPSHYRNLSHCRNLNRY 90 Query: 286 RNLHMILILDTF**RMMRVEEGNHSQSINRSKSLLKVRERSHPKSLLRVRERSHPKSLLR 465 RNL+ L + R +H S NR S + S S R R SH SL R Sbjct: 91 RNLNRCLSRN-------RYRNLSHCLSQNRCLSQNRCLNLSRYLSRNRYRNLSHYLSLNR 143 Query: 466 VRERSHLQNMNHPMNMKDHNNLQRNMVRNHPKSFLKVRERSHL*NTNH 609 R+H N+N +N+ NL R + NH + + +HL N NH Sbjct: 144 SLSRNHSLNLNRSLNLNRSLNLNRLLNLNHLLNLNHLLSLNHLLNLNH 191