BLASTX nr result
ID: Jatropha_contig00029492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00029492 (627 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320378.1| predicted protein [Populus trichocarpa] gi|2... 56 9e-06 >ref|XP_002320378.1| predicted protein [Populus trichocarpa] gi|222861151|gb|EEE98693.1| hypothetical protein POPTR_0014s13080g [Populus trichocarpa] Length = 136 Score = 55.8 bits (133), Expect = 9e-06 Identities = 30/46 (65%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = +1 Query: 364 CQKWSD----GLSVNQKSRVSVDESDNEQMNEKEKNKLFWETCLAS 489 CQ W GL V QKS VSVD S NE MNEKEK++LFWE CLAS Sbjct: 92 CQSWVHHVHVGLPVKQKSCVSVDSS-NESMNEKEKDRLFWEACLAS 136