BLASTX nr result
ID: Jatropha_contig00029262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00029262 (574 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521673.1| pentatricopeptide repeat-containing protein,... 74 2e-11 gb|EEE83726.2| hypothetical protein POPTR_0001s38850g [Populus t... 69 6e-10 gb|ESR55525.1| hypothetical protein CICLE_v10020422mg [Citrus cl... 67 2e-09 gb|EOY13642.1| Pentatricopeptide repeat (PPR) superfamily protei... 67 4e-09 ref|XP_004301959.1| PREDICTED: pentatricopeptide repeat-containi... 66 5e-09 ref|XP_004248491.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_006360029.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-07 ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] 58 1e-06 gb|ERN11525.1| hypothetical protein AMTR_s00022p00130870 [Ambore... 55 9e-06 >ref|XP_002521673.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539064|gb|EEF40660.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 341 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/59 (57%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTA-ASNICISEIVNG 399 KLI GLC +KLI EV+ VLKQM+KQGFVPKMGMW+ I+ S+ S + ++IC S+++ G Sbjct: 283 KLIDGLCKEKLIGEVDCVLKQMLKQGFVPKMGMWKHIVGSMLSESGDCTSICFSQVIGG 341 >gb|EEE83726.2| hypothetical protein POPTR_0001s38850g [Populus trichocarpa] Length = 292 Score = 69.3 bits (168), Expect = 6e-10 Identities = 31/58 (53%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTAASN-ICISEIVN 402 KL+HGLC ++L+R+++ VLKQM +QGFVPKMGMW ++++S+ S + + N + +SEIVN Sbjct: 231 KLVHGLCKERLLRDLDWVLKQMARQGFVPKMGMWVQMVQSVVSVSYSFNHVSLSEIVN 288 >gb|ESR55525.1| hypothetical protein CICLE_v10020422mg [Citrus clementina] Length = 404 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSL-FSRTAASNICISEIVN 402 KLIHGLCN KL+ +V+ VLK MV+QGFVP+MGMWREI+ + F + + + ++E V+ Sbjct: 343 KLIHGLCNQKLVEDVDWVLKTMVQQGFVPRMGMWREIVGCVTFGKDNRNRVYVTETVD 400 >gb|EOY13642.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 408 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLF-SRTAASNICISEIVN 402 KLIHG C +KL+REV+ LKQMV+QGFVPKMGMW ++++ +F ++ + IVN Sbjct: 350 KLIHGFCKEKLVREVDWALKQMVQQGFVPKMGMWTQMVKCVFHGSNTRDSLLLPAIVN 407 >ref|XP_004301959.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 399 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTAASNICIS 414 +LI GLC + + E++ VL+QM +QGFVPKMGMWR+I+RS+F + ++ C+S Sbjct: 337 QLIQGLCKENKVEELDWVLRQMTRQGFVPKMGMWRQIIRSVFPEKSNNHHCVS 389 >ref|XP_004248491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Solanum lycopersicum] Length = 387 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = -3 Query: 569 LIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTAASNIC 420 ++HGLC+ KL+ +++ VLKQMV+ GFVP+MGMW++IL LF C Sbjct: 330 IVHGLCDGKLVGDLDWVLKQMVRHGFVPRMGMWKKILGCLFPDGGCCTTC 379 >ref|XP_006360029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Solanum tuberosum] Length = 387 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/41 (58%), Positives = 35/41 (85%) Frame = -3 Query: 569 LIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLF 447 ++HGLC+ KL+ +++ VLKQM++ GFVP+MGMWR+IL LF Sbjct: 330 IVHGLCDGKLVGDLDWVLKQMMRHGFVPRMGMWRKILGCLF 370 >ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] gi|449503658|ref|XP_004162112.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] Length = 411 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 572 KLIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFS 444 KL+ GLC KL +V+ VLKQMV QGFVPK+GMW+ ILR + S Sbjct: 343 KLLSGLCKKKLTEDVDWVLKQMVMQGFVPKVGMWKVILRCMLS 385 >ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Vitis vinifera] Length = 393 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -3 Query: 569 LIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTAASNICISEI 408 +I+GLC + L+ +V +LKQMV+QGFVP+ MWR IL+++F R + + + E+ Sbjct: 338 MIYGLCKENLVADVVWILKQMVEQGFVPERWMWRRILQTMFPRNVSQSEIMEEV 391 >emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] Length = 393 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -3 Query: 569 LIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLFSRTAASNICISEI 408 +I+GLC + L+ +V +LKQMV+QGFVP+ MWR IL+++F R + + + E+ Sbjct: 338 VIYGLCKENLVADVVWILKQMVEQGFVPERWMWRRILQTMFPRNVSQSEIMEEV 391 >gb|ERN11525.1| hypothetical protein AMTR_s00022p00130870 [Amborella trichopoda] Length = 404 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -3 Query: 569 LIHGLCNDKLIREVELVLKQMVKQGFVPKMGMWREILRSLF 447 LI GLC+ L+R+V+ VL QM+ QGF+P+MG W IL SLF Sbjct: 351 LIDGLCDMDLLRDVDAVLTQMINQGFIPRMGTWMRILESLF 391