BLASTX nr result
ID: Jatropha_contig00028928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028928 (513 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554255.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 106 3e-21 ref|XP_002307588.1| predicted protein [Populus trichocarpa] gi|2... 104 1e-20 ref|XP_003521247.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 102 7e-20 gb|ESR57294.1| hypothetical protein CICLE_v10020348mg [Citrus cl... 100 2e-19 ref|XP_002520726.1| potassium channel regulatory factor, putativ... 100 2e-19 emb|CBI28698.3| unnamed protein product [Vitis vinifera] 99 7e-19 ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 99 7e-19 gb|EOX94743.1| Splicing factor Prp18 family protein isoform 1 [T... 97 2e-18 ref|XP_004146980.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 97 3e-18 ref|XP_004493674.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 95 1e-17 ref|XP_006349682.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 93 4e-17 ref|XP_004247169.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 93 4e-17 gb|EMJ01135.1| hypothetical protein PRUPE_ppa006327mg [Prunus pe... 92 5e-17 ref|NP_563676.1| splicing factor Prp18-like protein [Arabidopsis... 92 5e-17 gb|ESW21032.1| hypothetical protein PHAVU_005G035400g [Phaseolus... 92 7e-17 gb|ESQ36615.1| hypothetical protein EUTSA_v10009621mg [Eutrema s... 91 2e-16 ref|XP_006306008.1| hypothetical protein CARUB_v10011298mg [Caps... 89 6e-16 ref|XP_004290603.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 89 6e-16 ref|XP_002892149.1| splicing factor Prp18 family protein [Arabid... 89 6e-16 gb|EOX94744.1| Splicing factor Prp18 family protein isoform 2, p... 84 2e-14 >ref|XP_003554255.1| PREDICTED: pre-mRNA-splicing factor 18-like [Glycine max] Length = 411 Score = 106 bits (264), Expect = 3e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEE 177 VK LMTFCQRRYPT+PSKAVEFNSLANGSDLHSLLAEER SGGNQAS+ RLR+MPAP + Sbjct: 352 VKRLMTFCQRRYPTLPSKAVEFNSLANGSDLHSLLAEERFSGGNQASEERLRIMPAPRD 410 >ref|XP_002307588.1| predicted protein [Populus trichocarpa] gi|222857037|gb|EEE94584.1| splicing factor Prp18 family protein [Populus trichocarpa] Length = 420 Score = 104 bits (259), Expect = 1e-20 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GNQ S+GRLRLMPAP+EN Sbjct: 361 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERVFDGNQPSEGRLRLMPAPDEN 420 >ref|XP_003521247.1| PREDICTED: pre-mRNA-splicing factor 18-like [Glycine max] Length = 413 Score = 102 bits (253), Expect = 7e-20 Identities = 51/61 (83%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQ-ASDGRLRLMPAPEE 177 VK LMTFCQRRYPT+PSKAVEFNSLANGSDLHSLLAEER SGGNQ AS+ RLR+MPAP + Sbjct: 353 VKRLMTFCQRRYPTLPSKAVEFNSLANGSDLHSLLAEERFSGGNQAASEERLRIMPAPRD 412 Query: 178 N 180 + Sbjct: 413 S 413 >gb|ESR57294.1| hypothetical protein CICLE_v10020348mg [Citrus clementina] Length = 416 Score = 100 bits (248), Expect = 2e-19 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEE SG NQ+S+ RLRLMPAP+E+ Sbjct: 357 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEETISGSNQSSEERLRLMPAPKES 416 >ref|XP_002520726.1| potassium channel regulatory factor, putative [Ricinus communis] gi|223540111|gb|EEF41688.1| potassium channel regulatory factor, putative [Ricinus communis] Length = 417 Score = 100 bits (248), Expect = 2e-19 Identities = 49/60 (81%), Positives = 52/60 (86%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GNQ S+GRL+LM PEEN Sbjct: 358 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERVHSGNQPSEGRLQLMAGPEEN 417 >emb|CBI28698.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 98.6 bits (244), Expect = 7e-19 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 +K LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER SGGNQAS+ RL LM P+E+ Sbjct: 100 IKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFSGGNQASEERLHLMAPPKES 159 >ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like [Vitis vinifera] Length = 412 Score = 98.6 bits (244), Expect = 7e-19 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 +K LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER SGGNQAS+ RL LM P+E+ Sbjct: 353 IKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFSGGNQASEERLHLMAPPKES 412 >gb|EOX94743.1| Splicing factor Prp18 family protein isoform 1 [Theobroma cacao] Length = 415 Score = 97.1 bits (240), Expect = 2e-18 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEE+ SGG+ +SD RLRLMPAP+E+ Sbjct: 357 VKRLMTFCQRRYPTLPSKAVEFNSLANGSDLQSLLAEEKVSGGS-SSDDRLRLMPAPKES 415 >ref|XP_004146980.1| PREDICTED: pre-mRNA-splicing factor 18-like [Cucumis sativus] gi|449491488|ref|XP_004158914.1| PREDICTED: pre-mRNA-splicing factor 18-like [Cucumis sativus] Length = 420 Score = 96.7 bits (239), Expect = 3e-18 Identities = 48/61 (78%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQ-ASDGRLRLMPAPEE 177 +K LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER SGG + SD RLR+MPAPE+ Sbjct: 360 IKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERVSGGGKLGSDERLRIMPAPED 419 Query: 178 N 180 + Sbjct: 420 S 420 >ref|XP_004493674.1| PREDICTED: pre-mRNA-splicing factor 18-like [Cicer arietinum] Length = 411 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/60 (78%), Positives = 51/60 (85%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAPEEN 180 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER SG NQ S+ RLR+M P E+ Sbjct: 352 VKRLMTFCQRRYPTLPSKAVEFNSLANGSDLQSLLAEERFSGVNQTSEERLRIMAPPRES 411 >ref|XP_006349682.1| PREDICTED: pre-mRNA-splicing factor 18-like [Solanum tuberosum] Length = 413 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPA 168 VK LMTFCQRRYP +PSKAVEFNSLANGSDL SLLAEE +SGG+Q S+ RLR+MPA Sbjct: 358 VKRLMTFCQRRYPAMPSKAVEFNSLANGSDLQSLLAEEGTSGGSQTSEERLRIMPA 413 >ref|XP_004247169.1| PREDICTED: pre-mRNA-splicing factor 18-like [Solanum lycopersicum] Length = 413 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPA 168 VK LMTFCQRRYP +PSKAVEFNSLANGSDL SLLAEE +SGG+Q S+ RLR+MPA Sbjct: 358 VKRLMTFCQRRYPAMPSKAVEFNSLANGSDLQSLLAEEGTSGGSQTSEERLRIMPA 413 >gb|EMJ01135.1| hypothetical protein PRUPE_ppa006327mg [Prunus persica] Length = 417 Score = 92.4 bits (228), Expect = 5e-17 Identities = 47/58 (81%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEER-SSGGNQASDGRLRLMPAP 171 VK LMTFCQRRYP +PSKAVEFNSLANGSDL SLLA ER SSGGNQAS+ +L +MPAP Sbjct: 360 VKRLMTFCQRRYPAMPSKAVEFNSLANGSDLQSLLASERASSGGNQASEEKLLIMPAP 417 >ref|NP_563676.1| splicing factor Prp18-like protein [Arabidopsis thaliana] gi|4587563|gb|AAD25794.1|AC006550_2 Similar to gb|U51990 pre-mRNA-splicing factor hPrp18 from Homo sapiens. ESTs gb|T46391 and gb|AA721815 come from this gene [Arabidopsis thaliana] gi|13430636|gb|AAK25940.1|AF360230_1 unknown protein [Arabidopsis thaliana] gi|15293173|gb|AAK93697.1| unknown protein [Arabidopsis thaliana] gi|332189414|gb|AEE27535.1| splicing factor Prp18-like protein [Arabidopsis thaliana] Length = 420 Score = 92.4 bits (228), Expect = 5e-17 Identities = 48/62 (77%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGN--QASDGRLRLMPAPE 174 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GGN Q S+ RLRLMP+ Sbjct: 359 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFFGGNREQVSEERLRLMPSQS 418 Query: 175 EN 180 E+ Sbjct: 419 ES 420 >gb|ESW21032.1| hypothetical protein PHAVU_005G035400g [Phaseolus vulgaris] Length = 411 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 1/61 (1%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQ-ASDGRLRLMPAPEE 177 +K LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER SG NQ S+ R R+MPAP + Sbjct: 351 IKRLMTFCQRRYPTLPSKAVEFNSLANGSDLQSLLAEERFSGVNQTTSEERFRIMPAPRD 410 Query: 178 N 180 + Sbjct: 411 S 411 >gb|ESQ36615.1| hypothetical protein EUTSA_v10009621mg [Eutrema salsugineum] Length = 424 Score = 90.9 bits (224), Expect = 2e-16 Identities = 47/62 (75%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQ--ASDGRLRLMPAPE 174 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GGN+ S+ RLRLMP+ Sbjct: 363 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFFGGNREHVSEERLRLMPSQN 422 Query: 175 EN 180 E+ Sbjct: 423 ES 424 >ref|XP_006306008.1| hypothetical protein CARUB_v10011298mg [Capsella rubella] gi|482574719|gb|EOA38906.1| hypothetical protein CARUB_v10011298mg [Capsella rubella] Length = 425 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/62 (74%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGN--QASDGRLRLMPAPE 174 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GG+ + S+ RLRLMP+ Sbjct: 364 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFFGGDRERVSEERLRLMPSQS 423 Query: 175 EN 180 E+ Sbjct: 424 ES 425 >ref|XP_004290603.1| PREDICTED: pre-mRNA-splicing factor 18-like [Fragaria vesca subsp. vesca] Length = 415 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/57 (77%), Positives = 47/57 (82%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLRLMPAP 171 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLL E SG +Q + RLRLMPAP Sbjct: 359 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLQMETDSGSSQVFEERLRLMPAP 415 >ref|XP_002892149.1| splicing factor Prp18 family protein [Arabidopsis lyrata subsp. lyrata] gi|297337991|gb|EFH68408.1| splicing factor Prp18 family protein [Arabidopsis lyrata subsp. lyrata] Length = 417 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/62 (74%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGN--QASDGRLRLMPAPE 174 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEER GG+ + S+ RLRLMP+ Sbjct: 356 VKRLMTFCQRRYPTMPSKAVEFNSLANGSDLQSLLAEERFFGGDRERVSEERLRLMPSQS 415 Query: 175 EN 180 E+ Sbjct: 416 ES 417 >gb|EOX94744.1| Splicing factor Prp18 family protein isoform 2, partial [Theobroma cacao] Length = 407 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +1 Query: 1 VKTLMTFCQRRYPTVPSKAVEFNSLANGSDLHSLLAEERSSGGNQASDGRLR 156 VK LMTFCQRRYPT+PSKAVEFNSLANGSDL SLLAEE+ SGG+ +SD RLR Sbjct: 357 VKRLMTFCQRRYPTLPSKAVEFNSLANGSDLQSLLAEEKVSGGS-SSDDRLR 407