BLASTX nr result
ID: Jatropha_contig00028918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028918 (608 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY30235.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma ... 70 4e-10 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma ... 70 4e-10 ref|XP_003632777.1| PREDICTED: proteasome subunit alpha type-6 i... 70 4e-10 gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum] 70 4e-10 ref|XP_002516258.1| proteasome subunit alpha type, putative [Ric... 70 4e-10 ref|XP_002532723.1| proteasome subunit alpha type, putative [Ric... 70 4e-10 ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 i... 70 4e-10 gb|ADJ95344.1| PAA1 [Carica papaya] 70 6e-10 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus pe... 69 9e-10 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha ty... 69 9e-10 ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max... 69 9e-10 ref|XP_003541109.1| PREDICTED: proteasome subunit alpha type-6-l... 69 9e-10 gb|ACJ85916.1| unknown [Medicago truncatula] gi|388517215|gb|AFK... 69 9e-10 ref|XP_004141815.1| PREDICTED: proteasome subunit alpha type-6-l... 68 2e-09 ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-l... 68 2e-09 gb|ACN66752.1| PAA1 [Carica papaya] 68 2e-09 gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica] 68 2e-09 gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea] 67 3e-09 ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-l... 67 3e-09 ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6-l... 67 3e-09 >gb|EOY30235.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao] Length = 181 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYE+PVDVLAKW Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYELPVDVLAKW 117 >gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao] Length = 246 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYE+PVDVLAKW Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYELPVDVLAKW 117 >ref|XP_003632777.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Vitis vinifera] Length = 265 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYEMPVDVLA+W Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYEMPVDVLARW 117 >gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum] Length = 246 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYEMPVDVL+KW Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYEMPVDVLSKW 117 >ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis] gi|223544744|gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis] Length = 246 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYEMPVDVLA+W Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYEMPVDVLARW 117 >ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis] gi|223527531|gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis] Length = 246 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF+YGYEMPVDVLAKW Sbjct: 84 TADARTLVQQARNEAAEFRFKYGYEMPVDVLAKW 117 >ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Vitis vinifera] gi|147797489|emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera] gi|297742984|emb|CBI35851.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYEMPVDVLA+W Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYEMPVDVLARW 117 >gb|ADJ95344.1| PAA1 [Carica papaya] Length = 246 Score = 69.7 bits (169), Expect = 6e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRFRYGYEMPVD LAKW Sbjct: 84 TADARTLVQQARNEAAEFRFRYGYEMPVDALAKW 117 >gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica] Length = 246 Score = 68.9 bits (167), Expect = 9e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF+YGYEMPVDVLA+W Sbjct: 84 TADARTLVQQARNEAAEFRFKYGYEMPVDVLARW 117 >sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1 gi|4539545|emb|CAB39975.1| PRCI [Nicotiana tabacum] Length = 246 Score = 68.9 bits (167), Expect = 9e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF+YGYEMPVDVL+KW Sbjct: 84 TADARTLVQQARNEAAEFRFKYGYEMPVDVLSKW 117 >ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max] gi|12229897|sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1; AltName: Full=Proteasome iota subunit gi|3377794|gb|AAC28135.1| proteasome IOTA subunit [Glycine max] Length = 246 Score = 68.9 bits (167), Expect = 9e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF YGYEMPVDVLAKW Sbjct: 84 TADARTLVQQARNEAAEFRFTYGYEMPVDVLAKW 117 >ref|XP_003541109.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max] Length = 368 Score = 68.9 bits (167), Expect = 9e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF YGYEMPVDVLAKW Sbjct: 206 TADARTLVQQARNEAAEFRFTYGYEMPVDVLAKW 239 >gb|ACJ85916.1| unknown [Medicago truncatula] gi|388517215|gb|AFK46669.1| unknown [Medicago truncatula] Length = 246 Score = 68.9 bits (167), Expect = 9e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAE+RFRYGYEMPVDVL+KW Sbjct: 84 TADARTLVQQARNEAAEYRFRYGYEMPVDVLSKW 117 >ref|XP_004141815.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] Length = 130 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADAR+LVQQARNEAAEFRF+YGYEMPVDVLAKW Sbjct: 84 TADARSLVQQARNEAAEFRFQYGYEMPVDVLAKW 117 >ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] gi|449480500|ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] Length = 246 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADAR+LVQQARNEAAEFRF+YGYEMPVDVLAKW Sbjct: 84 TADARSLVQQARNEAAEFRFQYGYEMPVDVLAKW 117 >gb|ACN66752.1| PAA1 [Carica papaya] Length = 246 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEA EFRFRYGYEMPVD LAKW Sbjct: 84 TADARTLVQQARNEATEFRFRYGYEMPVDALAKW 117 >gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica] Length = 187 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLV QARNEAAEFRF+YGYEMPVDVLAKW Sbjct: 84 TADARTLVSQARNEAAEFRFKYGYEMPVDVLAKW 117 >gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea] Length = 246 Score = 67.4 bits (163), Expect = 3e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARN+AA+FRFRYGYEMPVDVLA+W Sbjct: 84 TADARTLVQQARNKAADFRFRYGYEMPVDVLARW 117 >ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer arietinum] gi|502087267|ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer arietinum] gi|502087270|ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer arietinum] Length = 246 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFR +YGYEMPVDVLAKW Sbjct: 84 TADARTLVQQARNEAAEFRHKYGYEMPVDVLAKW 117 >ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum lycopersicum] gi|565356827|ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum] Length = 246 Score = 67.4 bits (163), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 304 SADARTLVQQARNEAAEFRFRYGYEMPVDVLAKW 405 +ADARTLVQQARNEAAEFRF+YGYEMP DVL+KW Sbjct: 84 TADARTLVQQARNEAAEFRFKYGYEMPADVLSKW 117