BLASTX nr result
ID: Jatropha_contig00028818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028818 (497 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56186.1| hypothetical protein [Jatropha curcas] 66 4e-09 >gb|ADU56186.1| hypothetical protein [Jatropha curcas] Length = 66 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/51 (62%), Positives = 32/51 (62%) Frame = +1 Query: 82 MSQNQXXXXXXXXXXXXXXXXXXXGYPTKDGDTQNQVPVETKSRGDGFWKG 234 MSQNQ GYPTKDGDTQNQVPVETKSRGDGFWKG Sbjct: 1 MSQNQATAYPPPPPSNAYVAPPPAGYPTKDGDTQNQVPVETKSRGDGFWKG 51