BLASTX nr result
ID: Jatropha_contig00028802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028802 (427 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521832.1| conserved hypothetical protein [Ricinus comm... 73 4e-11 ref|XP_002313834.1| predicted protein [Populus trichocarpa] 73 4e-11 >ref|XP_002521832.1| conserved hypothetical protein [Ricinus communis] gi|223538870|gb|EEF40468.1| conserved hypothetical protein [Ricinus communis] Length = 75 Score = 72.8 bits (177), Expect = 4e-11 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = +2 Query: 71 MVIQRLEMCMELMKLALDFVFVVAEAIGIVIQQSTSTHSQSLPNHHFAPAVPFVG 235 MVIQRLEMC+ L+K+A++FV VVAEAIG+VIQQ+TS+ S LP HH + VPFVG Sbjct: 1 MVIQRLEMCVALVKIAMEFVIVVAEAIGVVIQQNTSS-SSHLPIHHSSGPVPFVG 54 >ref|XP_002313834.1| predicted protein [Populus trichocarpa] Length = 56 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = +2 Query: 71 MVIQRLEMCMELMKLALDFVFVVAEAIGIVIQQSTSTHSQSLPNHHFAPAVPFVGFLP 244 MVIQRLEMC+ L+KLA++F+ V EAIGIVIQQ+ + + L NHH+ VPFVGFLP Sbjct: 1 MVIQRLEMCIALVKLAMEFIMAVVEAIGIVIQQNGT--AAPLANHHYIAPVPFVGFLP 56