BLASTX nr result
ID: Jatropha_contig00028765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028765 (494 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516215.1| Indole-3-acetic acid-induced protein ARG7, p... 71 1e-10 ref|XP_002326143.1| SAUR family protein [Populus trichocarpa] gi... 59 6e-07 >ref|XP_002516215.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus communis] gi|223544701|gb|EEF46217.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus communis] Length = 161 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 39 TIPCEIETFKFLLKCMEHHPKDHQDNNSTEEFIKN 143 TIPCEIETFKFLLKCMEHHPKDHQD++S EEFI + Sbjct: 127 TIPCEIETFKFLLKCMEHHPKDHQDDSSNEEFINH 161 >ref|XP_002326143.1| SAUR family protein [Populus trichocarpa] gi|550336274|gb|ERP59365.1| auxin-responsive family protein [Populus trichocarpa] Length = 160 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 39 TIPCEIETFKFLLKCMEHHPKDHQDNNSTE 128 TIPCEIETFKFLLKCME HPKDH D S E Sbjct: 124 TIPCEIETFKFLLKCMESHPKDHDDEGSAE 153