BLASTX nr result
ID: Jatropha_contig00028740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028740 (552 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB86961.1| actin-2 [Sedum alfredii] 70 4e-10 gb|AGZ90151.1| actin 7, partial [Litsea cubeba] 70 4e-10 gb|ESR41095.1| hypothetical protein CICLE_v10025866mg [Citrus cl... 70 4e-10 dbj|BAO04185.1| actin, partial [Delphinium grandiflorum] 70 4e-10 dbj|BAN45712.1| putative actin, partial [Pyrus pyrifolia var. cu... 70 4e-10 dbj|BAN45711.1| putative actin, partial [Pyrus pyrifolia var. cu... 70 4e-10 gb|AFM38980.1| actin [Sophora viciifolia] 70 4e-10 gb|EOX92410.1| Actin 7 isoform 1 [Theobroma cacao] gi|508700516|... 70 4e-10 gb|AGK63075.1| actin 1 [Eleutherococcus senticosus] 70 4e-10 dbj|BAN13565.1| actin, partial [Chrysanthemum x morifolium] 70 4e-10 dbj|BAN13564.1| actin, partial [Chrysanthemum seticuspe f. boreale] 70 4e-10 gb|EMT00396.1| Actin-3 [Aegilops tauschii] 70 4e-10 gb|AGI15325.1| actin 1 [Dionaea muscipula] 70 4e-10 ref|XP_004306592.1| PREDICTED: actin-7-like [Fragaria vesca subs... 70 4e-10 gb|AFY06656.1| actin 2, partial [Carica papaya] 70 4e-10 ref|XP_004249866.1| PREDICTED: actin-7-like [Solanum lycopersicu... 70 4e-10 ref|XP_004235068.1| PREDICTED: actin-7-like [Solanum lycopersicu... 70 4e-10 ref|XP_004166461.1| PREDICTED: LOW QUALITY PROTEIN: actin-101-li... 70 4e-10 ref|XP_004147353.1| PREDICTED: actin-7-like [Cucumis sativus] gi... 70 4e-10 gb|ADV04491.1| beta-actin [Camellia sinensis] 70 4e-10 >gb|AHB86961.1| actin-2 [Sedum alfredii] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|AGZ90151.1| actin 7, partial [Litsea cubeba] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|ESR41095.1| hypothetical protein CICLE_v10025866mg [Citrus clementina] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >dbj|BAO04185.1| actin, partial [Delphinium grandiflorum] Length = 294 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 263 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 294 >dbj|BAN45712.1| putative actin, partial [Pyrus pyrifolia var. culta] Length = 345 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 314 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 345 >dbj|BAN45711.1| putative actin, partial [Pyrus pyrifolia var. culta] Length = 345 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 314 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 345 >gb|AFM38980.1| actin [Sophora viciifolia] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|EOX92410.1| Actin 7 isoform 1 [Theobroma cacao] gi|508700516|gb|EOX92412.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma cacao] Length = 516 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 485 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 516 >gb|AGK63075.1| actin 1 [Eleutherococcus senticosus] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >dbj|BAN13565.1| actin, partial [Chrysanthemum x morifolium] Length = 70 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 39 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 70 >dbj|BAN13564.1| actin, partial [Chrysanthemum seticuspe f. boreale] Length = 280 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 249 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 280 >gb|EMT00396.1| Actin-3 [Aegilops tauschii] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|AGI15325.1| actin 1 [Dionaea muscipula] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >ref|XP_004306592.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|AFY06656.1| actin 2, partial [Carica papaya] Length = 214 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 183 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 214 >ref|XP_004249866.1| PREDICTED: actin-7-like [Solanum lycopersicum] gi|565368792|ref|XP_006351025.1| PREDICTED: actin-7-like [Solanum tuberosum] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >ref|XP_004235068.1| PREDICTED: actin-7-like [Solanum lycopersicum] gi|565377330|ref|XP_006355138.1| PREDICTED: actin-7-like [Solanum tuberosum] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >ref|XP_004166461.1| PREDICTED: LOW QUALITY PROTEIN: actin-101-like [Cucumis sativus] Length = 107 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 76 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 107 >ref|XP_004147353.1| PREDICTED: actin-7-like [Cucumis sativus] gi|449461823|ref|XP_004148641.1| PREDICTED: actin-7-like [Cucumis sativus] gi|449532903|ref|XP_004173417.1| PREDICTED: actin-7-like [Cucumis sativus] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|ADV04491.1| beta-actin [Camellia sinensis] Length = 377 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 377