BLASTX nr result
ID: Jatropha_contig00028494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028494 (549 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67212.1| hypothetical protein [Jatropha curcas] 80 4e-13 gb|ADJ67183.1| hypothetical protein [Jatropha curcas] 69 9e-10 gb|ADJ67176.1| hypothetical protein [Jatropha curcas] 65 1e-08 gb|ADJ67181.1| glucose-inhibited division protein b [Jatropha cu... 59 7e-07 >gb|ADJ67212.1| hypothetical protein [Jatropha curcas] Length = 78 Score = 79.7 bits (195), Expect = 4e-13 Identities = 48/63 (76%), Positives = 48/63 (76%) Frame = +3 Query: 12 MKKAFLLICILLATISFSPSLTSARELAAIGKDARIPIPKGWPRPGKPTPLPFRCSPGKK 191 MKKAFLLICILLATIS SPSLTSARELAAIGKDA IPI W PGK PF C KK Sbjct: 1 MKKAFLLICILLATISLSPSLTSARELAAIGKDAGIPI--RWKWPGK----PFGCLV-KK 53 Query: 192 NCL 200 NCL Sbjct: 54 NCL 56 >gb|ADJ67183.1| hypothetical protein [Jatropha curcas] Length = 71 Score = 68.6 bits (166), Expect = 9e-10 Identities = 41/56 (73%), Positives = 42/56 (75%) Frame = +3 Query: 33 ICILLATISFSPSLTSARELAAIGKDARIPIPKGWPRPGKPTPLPFRCSPGKKNCL 200 ICILLATIS SPSLTSARELAAIGKDA IPI + W PGK PF C KKNCL Sbjct: 1 ICILLATISLSPSLTSARELAAIGKDAGIPIRRKW--PGK----PFGCLV-KKNCL 49 >gb|ADJ67176.1| hypothetical protein [Jatropha curcas] Length = 105 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 121 GILASFPIAANSLAEVREGEKEMVAKRMQIRRKAFFM 11 GI ASFPIAANSLAEVREGE+EMV KRMQ+RRKAFF+ Sbjct: 69 GIPASFPIAANSLAEVREGEREMVVKRMQMRRKAFFI 105 >gb|ADJ67181.1| glucose-inhibited division protein b [Jatropha curcas] Length = 80 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/52 (71%), Positives = 37/52 (71%) Frame = +3 Query: 45 LATISFSPSLTSARELAAIGKDARIPIPKGWPRPGKPTPLPFRCSPGKKNCL 200 LATIS SPSLTSARELAAIGKDA IPI W PGK PF C KKNCL Sbjct: 14 LATISLSPSLTSARELAAIGKDAGIPI--RWKWPGK----PFGCLV-KKNCL 58