BLASTX nr result
ID: Jatropha_contig00028244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00028244 (549 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi comple... 101 1e-19 emb|CBI38713.3| unnamed protein product [Vitis vinifera] 101 1e-19 gb|EEE81948.2| hypothetical protein POPTR_0002s18030g [Populus t... 101 1e-19 gb|EPS69058.1| hypothetical protein M569_05707, partial [Genlise... 101 1e-19 ref|XP_004494974.1| PREDICTED: conserved oligomeric Golgi comple... 101 1e-19 ref|XP_004166514.1| PREDICTED: LOW QUALITY PROTEIN: conserved ol... 101 1e-19 ref|XP_004140637.1| PREDICTED: conserved oligomeric Golgi comple... 101 1e-19 ref|XP_003626606.1| Conserved oligomeric Golgi complex subunit [... 101 1e-19 ref|XP_002302674.1| predicted protein [Populus trichocarpa] 101 1e-19 gb|ESW11010.1| hypothetical protein PHAVU_009G257900g [Phaseolus... 100 3e-19 gb|ESW10973.1| hypothetical protein PHAVU_009G254600g [Phaseolus... 100 3e-19 gb|EMJ21435.1| hypothetical protein PRUPE_ppa001994mg [Prunus pe... 100 3e-19 ref|XP_002515075.1| conserved hypothetical protein [Ricinus comm... 100 3e-19 gb|ESR57968.1| hypothetical protein CICLE_v10018998mg [Citrus cl... 99 5e-19 gb|EOY26292.1| Oligomeric Golgi complex subunit 4 [Theobroma cacao] 99 6e-19 gb|ESQ37795.1| hypothetical protein EUTSA_v10028369mg [Eutrema s... 99 8e-19 ref|XP_006286848.1| hypothetical protein CARUB_v10003876mg [Caps... 99 8e-19 gb|AAB61014.1| A_IG002N01.1 gene product [Arabidopsis thaliana] 99 8e-19 ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] ... 99 8e-19 ref|NP_001154198.1| uncharacterized protein [Arabidopsis thalian... 99 8e-19 >ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Vitis vinifera] Length = 1105 Score = 101 bits (252), Expect = 1e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL Sbjct: 1057 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 1105 >emb|CBI38713.3| unnamed protein product [Vitis vinifera] Length = 707 Score = 101 bits (252), Expect = 1e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL Sbjct: 659 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 707 >gb|EEE81948.2| hypothetical protein POPTR_0002s18030g [Populus trichocarpa] Length = 763 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 715 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 763 >gb|EPS69058.1| hypothetical protein M569_05707, partial [Genlisea aurea] Length = 739 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 691 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 739 >ref|XP_004494974.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Cicer arietinum] Length = 1302 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 1254 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 1302 >ref|XP_004166514.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex subunit 4-like [Cucumis sativus] Length = 751 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 703 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 751 >ref|XP_004140637.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Cucumis sativus] Length = 751 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 703 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 751 >ref|XP_003626606.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] gi|87240849|gb|ABD32707.1| Conserved oligomeric Golgi complex component 4, related [Medicago truncatula] gi|355501621|gb|AES82824.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] Length = 747 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 699 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 747 >ref|XP_002302674.1| predicted protein [Populus trichocarpa] Length = 177 Score = 101 bits (251), Expect = 1e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAALKL Sbjct: 129 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 177 >gb|ESW11010.1| hypothetical protein PHAVU_009G257900g [Phaseolus vulgaris] Length = 741 Score = 100 bits (248), Expect = 3e-19 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAA+KL Sbjct: 693 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAVKL 741 >gb|ESW10973.1| hypothetical protein PHAVU_009G254600g [Phaseolus vulgaris] Length = 740 Score = 100 bits (248), Expect = 3e-19 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAA+KL Sbjct: 692 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAVKL 740 >gb|EMJ21435.1| hypothetical protein PRUPE_ppa001994mg [Prunus persica] Length = 732 Score = 100 bits (248), Expect = 3e-19 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAI+ALKL Sbjct: 684 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAISALKL 732 >ref|XP_002515075.1| conserved hypothetical protein [Ricinus communis] gi|223545555|gb|EEF47059.1| conserved hypothetical protein [Ricinus communis] Length = 746 Score = 100 bits (248), Expect = 3e-19 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAI+ALKL Sbjct: 698 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAISALKL 746 >gb|ESR57968.1| hypothetical protein CICLE_v10018998mg [Citrus clementina] Length = 745 Score = 99.4 bits (246), Expect = 5e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIA LKL Sbjct: 697 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIALLKL 745 >gb|EOY26292.1| Oligomeric Golgi complex subunit 4 [Theobroma cacao] Length = 750 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVL LR+DFKPEAIAALKL Sbjct: 702 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLSLRVDFKPEAIAALKL 750 >gb|ESQ37795.1| hypothetical protein EUTSA_v10028369mg [Eutrema salsugineum] Length = 1136 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR++FKPE+IAALKL Sbjct: 1088 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 1136 >ref|XP_006286848.1| hypothetical protein CARUB_v10003876mg [Capsella rubella] gi|482555554|gb|EOA19746.1| hypothetical protein CARUB_v10003876mg [Capsella rubella] Length = 1116 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR++FKPE+IAALKL Sbjct: 1068 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 1116 >gb|AAB61014.1| A_IG002N01.1 gene product [Arabidopsis thaliana] Length = 177 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR++FKPE+IAALKL Sbjct: 129 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 177 >ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] gi|332656619|gb|AEE82019.1| uncharacterized protein AT4G01400 [Arabidopsis thaliana] Length = 1110 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR++FKPE+IAALKL Sbjct: 1062 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 1110 >ref|NP_001154198.1| uncharacterized protein [Arabidopsis thaliana] gi|75154279|sp|Q8L838.1|COG4_ARATH RecName: Full=Conserved oligomeric Golgi complex subunit 4; Short=COG complex subunit 4; AltName: Full=Component of oligomeric Golgi complex 4 gi|21539537|gb|AAM53321.1| unknown protein [Arabidopsis thaliana] gi|34098793|gb|AAQ56779.1| At4g01400 [Arabidopsis thaliana] gi|332656620|gb|AEE82020.1| uncharacterized protein AT4G01400 [Arabidopsis thaliana] Length = 738 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 149 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLR++FKPE+IAALKL Sbjct: 690 LNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 738