BLASTX nr result
ID: Jatropha_contig00027769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00027769 (666 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531471.1| mutt domain protein, putative [Ricinus commu... 68 2e-09 >ref|XP_002531471.1| mutt domain protein, putative [Ricinus communis] gi|223528925|gb|EEF30921.1| mutt domain protein, putative [Ricinus communis] Length = 368 Score = 68.2 bits (165), Expect = 2e-09 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +3 Query: 489 EIALLEKTYSCPFLSPRHVAAVRFSPEF-GSCRGMSLKVSCSSTSNGTYLSKKANKSANE 665 EIAL+ T S P S RHV VR SPEF SCRG+ LKVSCSS+SNGTYLSKK + E Sbjct: 15 EIALMATTRSSPCPSLRHVGGVRLSPEFIWSCRGVFLKVSCSSSSNGTYLSKKHISAGQE 74