BLASTX nr result
ID: Jatropha_contig00027223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00027223 (461 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524681.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 ref|XP_002305655.1| f-box family protein [Populus trichocarpa] g... 69 8e-10 ref|XP_002316660.1| predicted protein [Populus trichocarpa] 66 5e-09 gb|ESR62452.1| hypothetical protein CICLE_v10016832mg [Citrus cl... 62 7e-08 >ref|XP_002524681.1| conserved hypothetical protein [Ricinus communis] gi|223536042|gb|EEF37700.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 5 EAPNAPKVPRSYKSRLNGKNLADISVALFASPRKELFLETE 127 EAPNAPKV R YKSRLN KNL DISVALFASPRK LF+ETE Sbjct: 158 EAPNAPKVSRCYKSRLNRKNLMDISVALFASPRKGLFMETE 198 >ref|XP_002305655.1| f-box family protein [Populus trichocarpa] gi|222848619|gb|EEE86166.1| F-box family protein [Populus trichocarpa] Length = 189 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 2 IEAPNAPKVPRSYKSRLNGKNLADISVALFASPRKELFLETE 127 IEAPNAPK RSYKSRLN K++AD+SVALFASP+K LF+ETE Sbjct: 147 IEAPNAPKQRRSYKSRLNRKSIADVSVALFASPKKGLFMETE 188 >ref|XP_002316660.1| predicted protein [Populus trichocarpa] Length = 189 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 2 IEAPNAPKVPRSYKSRLNGKNLADISVALFASPRKELFLETE 127 IEAPNAPK RSYKS LN K++AD+SVALFASP+K LF+ETE Sbjct: 147 IEAPNAPKQRRSYKSLLNRKSIADVSVALFASPKKGLFMETE 188 >gb|ESR62452.1| hypothetical protein CICLE_v10016832mg [Citrus clementina] Length = 190 Score = 62.0 bits (149), Expect = 7e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 2 IEAPNAPKVPRSYKSRLNGKNLADISVALFASPRKELFLETE 127 +EAPNAP+ R+YKSRL + LADISVALFASP+K LF+E E Sbjct: 146 VEAPNAPRQMRAYKSRLTSQKLADISVALFASPKKNLFMEEE 187