BLASTX nr result
ID: Jatropha_contig00027026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00027026 (602 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAN21416.1| cysteine rich secreted protein [Riptortus pedest... 62 1e-07 >dbj|BAN21416.1| cysteine rich secreted protein [Riptortus pedestris] Length = 84 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +1 Query: 22 VSRDQCSPTRYCPDGTLCCSDTYHCCPIGLTCCYNFTRCC 141 V+R+ CSPT YC DG CCS T CCPI LTCC N T CC Sbjct: 25 VNREDCSPTSYCADGFKCCSTT-KCCPINLTCCGNGTDCC 63