BLASTX nr result
ID: Jatropha_contig00026415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00026415 (264 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESQ43401.1| hypothetical protein EUTSA_v10015055mg [Eutrema s... 84 2e-14 ref|YP_173419.1| hypothetical protein NitaMp077 [Nicotiana tabac... 51 4e-11 emb|CBI35735.3| unnamed protein product [Vitis vinifera] 67 2e-09 >gb|ESQ43401.1| hypothetical protein EUTSA_v10015055mg [Eutrema salsugineum] Length = 114 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/48 (87%), Positives = 43/48 (89%), Gaps = 3/48 (6%) Frame = +3 Query: 3 GHTEQVREIGPAPLY*KKGPLREVKPRTYGSRGSSPVNIGSN---NRG 137 GHTEQVREIGPAPLY K+GPLREVKPRTYGSR SSPVNIGSN NRG Sbjct: 59 GHTEQVREIGPAPLYKKQGPLREVKPRTYGSRDSSPVNIGSNKTSNRG 106 >ref|YP_173419.1| hypothetical protein NitaMp077 [Nicotiana tabacum] gi|56806582|dbj|BAD83483.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 104 Score = 51.2 bits (121), Expect(2) = 4e-11 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 88 MEVGARPRSILDQTIGGRSTDLFF 159 MEVGARPRSILDQTIGGRSTDLFF Sbjct: 1 MEVGARPRSILDQTIGGRSTDLFF 24 Score = 42.0 bits (97), Expect(2) = 4e-11 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 156 FLLIQYNRGKDRTVPYRD 209 FLLIQYNRGKDRTVPYRD Sbjct: 24 FLLIQYNRGKDRTVPYRD 41 >emb|CBI35735.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 264 RRTEEVCPARGGSVESFCCLGRELYDLFPY 175 RRTEEVCPARGGSVESFCCL RELYDLFPY Sbjct: 62 RRTEEVCPARGGSVESFCCLSRELYDLFPY 91