BLASTX nr result
ID: Jatropha_contig00026229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00026229 (194 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 81 4e-17 gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] 81 4e-17 ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 80 1e-16 gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] 78 6e-16 ref|NP_001236432.1| allene oxide synthase [Glycine max] gi|82795... 76 2e-15 ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796... 74 1e-14 gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus... 74 1e-14 gb|AGV22361.1| chloroplast allene oxide synthase 6 [Gossypium ar... 72 4e-14 ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum]... 71 9e-14 ref|XP_006366441.1| PREDICTED: allene oxide synthase, chloroplas... 71 9e-14 emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] 71 9e-14 gb|EMJ23719.1| hypothetical protein PRUPE_ppa004133mg [Prunus pe... 73 1e-13 gb|AGP25595.1| AOS1 [Aquilaria sinensis] 73 1e-13 emb|CAG17875.1| allene oxide synthase [Prunus persica] 73 1e-13 dbj|BAJ78216.1| allene oxide synthase [Lotus japonicus] 71 2e-13 ref|XP_004291923.1| PREDICTED: allene oxide synthase, chloroplas... 72 2e-13 gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arbor... 72 2e-13 gb|EOY14651.1| Allene oxide synthase [Theobroma cacao] 73 2e-13 emb|CAC86897.1| allene oxide synthase [Medicago truncatula] 71 3e-13 gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] 69 7e-13 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 81.3 bits (199), Expect(2) = 4e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FYSSAGS+L+EAEKMGIS++EACHNILFATCFNT GG+KIF P Sbjct: 296 FYSSAGSLLDEAEKMGISREEACHNILFATCFNTFGGLKIFFP 338 Score = 32.0 bits (71), Expect(2) = 4e-17 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPNILKWIGRA Sbjct: 334 KIFFPNILKWIGRA 347 >gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] Length = 457 Score = 81.3 bits (199), Expect(2) = 4e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FYSSAGS+L+EAEKMGIS++EACHNILFATCFNT GG+KIF P Sbjct: 229 FYSSAGSLLDEAEKMGISREEACHNILFATCFNTFGGLKIFFP 271 Score = 32.0 bits (71), Expect(2) = 4e-17 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPNILKWIGRA Sbjct: 267 KIFFPNILKWIGRA 280 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 79.7 bits (195), Expect(2) = 1e-16 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 F SSAGS+L+EAEKMGIS+DEACHN+LFATCFNT GGMKIF P Sbjct: 292 FNSSAGSLLDEAEKMGISRDEACHNLLFATCFNTFGGMKIFFP 334 Score = 32.0 bits (71), Expect(2) = 1e-16 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPNILKWIGRA Sbjct: 330 KIFFPNILKWIGRA 343 >gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 77.8 bits (190), Expect(2) = 6e-16 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FYSS GSVL+EAE+MG++++EACHNILFATCFNT GG+KIF P Sbjct: 296 FYSSGGSVLDEAERMGLTREEACHNILFATCFNTFGGLKIFFP 338 Score = 31.6 bits (70), Expect(2) = 6e-16 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 334 KIFFPNVLKWIGRA 347 >ref|NP_001236432.1| allene oxide synthase [Glycine max] gi|82795997|gb|ABB91776.1| allene oxide synthase [Glycine max] Length = 524 Score = 75.9 bits (185), Expect(2) = 2e-15 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+GSVL+EAE++GI++DEACHN+LFATCFN+ GGMK+F P Sbjct: 295 FYQSSGSVLDEAERLGITRDEACHNLLFATCFNSFGGMKLFFP 337 Score = 31.6 bits (70), Expect(2) = 2e-15 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 333 KLFFPNVLKWIGRA 346 >ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796032|gb|ABB91777.1| allene oxide synthase [Glycine max] gi|169786998|gb|ACA79943.1| chloroplast allene oxide synthase [Glycine max] Length = 519 Score = 73.6 bits (179), Expect(2) = 1e-14 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAE++GI++DEACHN+LFATCFN+ GGMK+F P Sbjct: 290 FYESSGLVLDEAERLGITRDEACHNLLFATCFNSFGGMKLFFP 332 Score = 31.6 bits (70), Expect(2) = 1e-14 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 328 KLFFPNVLKWIGRA 341 >gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] Length = 518 Score = 74.3 bits (181), Expect(2) = 1e-14 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FYSS+ SVL+EAE++GI++DEACHN+LFATCFN+ GGMK+F P Sbjct: 289 FYSSSTSVLDEAERLGITRDEACHNLLFATCFNSFGGMKLFFP 331 Score = 30.8 bits (68), Expect(2) = 1e-14 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN++KWIGRA Sbjct: 327 KLFFPNVMKWIGRA 340 >gb|AGV22361.1| chloroplast allene oxide synthase 6 [Gossypium arboreum] Length = 523 Score = 72.4 bits (176), Expect(2) = 4e-14 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+GS+ +EAEK+ IS++EACHN+LFATCFN+ GGMKIF P Sbjct: 294 FYESSGSIQDEAEKLSISREEACHNLLFATCFNSFGGMKIFFP 336 Score = 30.8 bits (68), Expect(2) = 4e-14 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 332 KIFFPNMLKWIGRA 345 >ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum] gi|7581989|emb|CAB88032.1| allene oxide synthase [Solanum lycopersicum] Length = 534 Score = 71.2 bits (173), Expect(2) = 9e-14 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY ++ SVL+EAEK+GIS++EACHN+LFATCFN+ GG+KIF P Sbjct: 305 FYENSTSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFP 347 Score = 30.8 bits (68), Expect(2) = 9e-14 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 343 KIFFPNMLKWIGRA 356 >ref|XP_006366441.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum tuberosum] Length = 530 Score = 71.2 bits (173), Expect(2) = 9e-14 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY ++ SVL+EAEK+GIS++EACHN+LFATCFN+ GG+KIF P Sbjct: 301 FYENSTSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFP 343 Score = 30.8 bits (68), Expect(2) = 9e-14 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 339 KIFFPNMLKWIGRA 352 >emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] Length = 530 Score = 71.2 bits (173), Expect(2) = 9e-14 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY ++ SVL+EAEK+GIS++EACHN+LFATCFN+ GG+KIF P Sbjct: 301 FYENSTSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFP 343 Score = 30.8 bits (68), Expect(2) = 9e-14 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWIGRA Sbjct: 339 KIFFPNMLKWIGRA 352 >gb|EMJ23719.1| hypothetical protein PRUPE_ppa004133mg [Prunus persica] Length = 528 Score = 73.2 bits (178), Expect(2) = 1e-13 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAE++G+S+DEACHN+LFATCFN+ GGMKI P Sbjct: 299 FYQSSGHVLDEAERLGVSRDEACHNLLFATCFNSFGGMKILFP 341 Score = 28.5 bits (62), Expect(2) = 1e-13 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FPN+LKWIGRA Sbjct: 337 KILFPNMLKWIGRA 350 >gb|AGP25595.1| AOS1 [Aquilaria sinensis] Length = 524 Score = 73.2 bits (178), Expect(2) = 1e-13 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAEK+GIS++EACHN++FATCFN+ GGMK+F P Sbjct: 295 FYQSSGVVLDEAEKLGISREEACHNLVFATCFNSFGGMKLFFP 337 Score = 28.5 bits (62), Expect(2) = 1e-13 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +3 Query: 153 KSFFPNILKWIGR 191 K FFPN++KWIGR Sbjct: 333 KLFFPNMIKWIGR 345 >emb|CAG17875.1| allene oxide synthase [Prunus persica] Length = 345 Score = 73.2 bits (178), Expect(2) = 1e-13 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAE++G+S+DEACHN+LFATCFN+ GGMKI P Sbjct: 173 FYQSSGHVLDEAERLGVSRDEACHNLLFATCFNSFGGMKILFP 215 Score = 28.5 bits (62), Expect(2) = 1e-13 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FPN+LKWIGRA Sbjct: 211 KILFPNMLKWIGRA 224 >dbj|BAJ78216.1| allene oxide synthase [Lotus japonicus] Length = 528 Score = 70.9 bits (172), Expect(2) = 2e-13 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G + +EAE++G+S++EACHN+LFATCFN+ GGMK+F P Sbjct: 299 FYQSSGFIFDEAERLGVSREEACHNLLFATCFNSLGGMKLFFP 341 Score = 30.0 bits (66), Expect(2) = 2e-13 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 153 KSFFPNILKWIGR 191 K FFPN+LKWIGR Sbjct: 337 KLFFPNVLKWIGR 349 >ref|XP_004291923.1| PREDICTED: allene oxide synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 525 Score = 72.4 bits (176), Expect(2) = 2e-13 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAE++G+S+DEACHN++FATCFN+ GGMKI P Sbjct: 296 FYQSSGHVLDEAERLGVSRDEACHNLIFATCFNSFGGMKILFP 338 Score = 28.5 bits (62), Expect(2) = 2e-13 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FPN+LKWIGRA Sbjct: 334 KILFPNMLKWIGRA 347 >gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arboreum] Length = 418 Score = 72.4 bits (176), Expect(2) = 2e-13 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G V +EAEK+GIS++E CHN+LFATCFNT GGMKIF P Sbjct: 189 FYHSSGFVQDEAEKLGISREEVCHNLLFATCFNTFGGMKIFFP 231 Score = 28.5 bits (62), Expect(2) = 2e-13 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN+LKWI RA Sbjct: 227 KIFFPNMLKWISRA 240 >gb|EOY14651.1| Allene oxide synthase [Theobroma cacao] Length = 531 Score = 73.2 bits (178), Expect(2) = 2e-13 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+G VL+EAEK+GIS++EACHN+LFATCFN+ GGM IF P Sbjct: 302 FYESSGFVLDEAEKLGISREEACHNLLFATCFNSLGGMNIFFP 344 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 159 FFPNILKWIGRA 194 FFPN+LKWI RA Sbjct: 342 FFPNMLKWIARA 353 >emb|CAC86897.1| allene oxide synthase [Medicago truncatula] Length = 524 Score = 71.2 bits (173), Expect(2) = 3e-13 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY+S+G LEEAE++ +SK+EACHN+LFATCFN+ GGMK+F P Sbjct: 295 FYASSGFALEEAERLDVSKEEACHNLLFATCFNSFGGMKLFFP 337 Score = 28.9 bits (63), Expect(2) = 3e-13 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +3 Query: 153 KSFFPNILKWIGR 191 K FFPN++KWIGR Sbjct: 333 KLFFPNLMKWIGR 345 >gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] Length = 537 Score = 68.9 bits (167), Expect(2) = 7e-13 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +2 Query: 38 FYSSAGSVLEEAEKMGISKDEACHNILFATCFNTSGGMKIFLP 166 FY S+ +V EEA+++GIS++EACHN+LF TCFN+ GGMKIF P Sbjct: 303 FYKSSEAVFEEADRLGISREEACHNLLFTTCFNSFGGMKIFFP 345 Score = 30.0 bits (66), Expect(2) = 7e-13 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 153 KSFFPNILKWIGRA 194 K FFPN++KWIGRA Sbjct: 341 KIFFPNMIKWIGRA 354