BLASTX nr result
ID: Jatropha_contig00026222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00026222 (776 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531488.1| serine/arginine rich splicing factor, putati... 69 2e-09 gb|EOX98800.1| Serine/arginine rich splicing factor, putative is... 64 7e-08 ref|XP_004504791.1| PREDICTED: serine/arginine-rich splicing fac... 64 7e-08 gb|AGE46120.1| arginine/serine-rich splicing factor SC30 transcr... 64 7e-08 tpg|DAA63676.1| TPA: hypothetical protein ZEAMMB73_707044 [Zea m... 64 7e-08 gb|AFK40654.1| unknown [Medicago truncatula] 64 7e-08 ref|XP_003531034.1| PREDICTED: uncharacterized protein LOC100778... 64 7e-08 ref|XP_003524737.1| PREDICTED: uncharacterized protein LOC100804... 64 7e-08 ref|XP_003615647.1| Splicing factor, arginine/serine-rich [Medic... 64 7e-08 gb|ACU21281.1| unknown [Glycine max] 64 7e-08 ref|XP_002274860.1| PREDICTED: uncharacterized protein LOC100242... 64 7e-08 ref|NP_001169755.1| hypothetical protein [Zea mays] gi|224031469... 64 7e-08 ref|XP_003615646.1| Splicing factor, arginine/serine-rich [Medic... 64 7e-08 ref|XP_004303347.1| PREDICTED: uncharacterized protein LOC101310... 63 9e-08 gb|ACR36750.1| unknown [Zea mays] gi|414590933|tpg|DAA41504.1| T... 63 1e-07 gb|ACF88377.1| unknown [Zea mays] gi|414590930|tpg|DAA41501.1| T... 63 1e-07 ref|NP_001140562.1| uncharacterized protein LOC100272627 [Zea ma... 63 1e-07 ref|XP_004958367.1| PREDICTED: serine/arginine-rich splicing fac... 62 2e-07 ref|XP_004958366.1| PREDICTED: serine/arginine-rich splicing fac... 62 2e-07 gb|ESW31092.1| hypothetical protein PHAVU_002G208600g [Phaseolus... 62 2e-07 >ref|XP_002531488.1| serine/arginine rich splicing factor, putative [Ricinus communis] gi|223528897|gb|EEF30895.1| serine/arginine rich splicing factor, putative [Ricinus communis] Length = 257 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIEPVP Sbjct: 78 DGRVVDGREITVQFAKYGPNAERIHKGRIIEPVP 111 >gb|EOX98800.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] gi|508706906|gb|EOX98802.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] Length = 257 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRVVDGREITVQFAKYGPNAERIHKGRIIESFP 111 >ref|XP_004504791.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X1 [Cicer arietinum] Length = 270 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >gb|AGE46120.1| arginine/serine-rich splicing factor SC30 transcript I [Sorghum bicolor] Length = 250 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 78 DGRLVDGREIMVQFAKYGPNAERINKGRIVEPVP 111 >tpg|DAA63676.1| TPA: hypothetical protein ZEAMMB73_707044 [Zea mays] Length = 207 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIVEPVP 112 >gb|AFK40654.1| unknown [Medicago truncatula] Length = 267 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >ref|XP_003531034.1| PREDICTED: uncharacterized protein LOC100778928 [Glycine max] Length = 267 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >ref|XP_003524737.1| PREDICTED: uncharacterized protein LOC100804370 [Glycine max] Length = 267 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >ref|XP_003615647.1| Splicing factor, arginine/serine-rich [Medicago truncatula] gi|355516982|gb|AES98605.1| Splicing factor, arginine/serine-rich [Medicago truncatula] Length = 140 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >gb|ACU21281.1| unknown [Glycine max] Length = 254 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >ref|XP_002274860.1| PREDICTED: uncharacterized protein LOC100242306 [Vitis vinifera] gi|296086805|emb|CBI32954.3| unnamed protein product [Vitis vinifera] Length = 255 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRI+E P Sbjct: 78 DGRIVDGREITVQFAKYGPNAERIHKGRIVETFP 111 >ref|NP_001169755.1| hypothetical protein [Zea mays] gi|224031469|gb|ACN34810.1| unknown [Zea mays] gi|414887660|tpg|DAA63674.1| TPA: hypothetical protein ZEAMMB73_707044 [Zea mays] gi|414887661|tpg|DAA63675.1| TPA: hypothetical protein ZEAMMB73_707044 [Zea mays] Length = 246 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIVEPVP 112 >ref|XP_003615646.1| Splicing factor, arginine/serine-rich [Medicago truncatula] gi|217073250|gb|ACJ84984.1| unknown [Medicago truncatula] gi|355516981|gb|AES98604.1| Splicing factor, arginine/serine-rich [Medicago truncatula] Length = 267 Score = 63.5 bits (153), Expect = 7e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRIIE P Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIETSP 111 >ref|XP_004303347.1| PREDICTED: uncharacterized protein LOC101310334 [Fragaria vesca subsp. vesca] Length = 263 Score = 63.2 bits (152), Expect = 9e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREITVQFAKYGPNAERIHKGRI E +P Sbjct: 78 DGRVVGGREITVQFAKYGPNAERIHKGRITESLP 111 >gb|ACR36750.1| unknown [Zea mays] gi|414590933|tpg|DAA41504.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] gi|414590934|tpg|DAA41505.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 190 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVP 112 >gb|ACF88377.1| unknown [Zea mays] gi|414590930|tpg|DAA41501.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] gi|414590931|tpg|DAA41502.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 238 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVP 112 >ref|NP_001140562.1| uncharacterized protein LOC100272627 [Zea mays] gi|194699996|gb|ACF84082.1| unknown [Zea mays] gi|414590932|tpg|DAA41503.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 251 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DGR V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVP 112 >ref|XP_004958367.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X2 [Setaria italica] Length = 250 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DG+ V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 78 DGKLVDGREIMVQFAKYGPNAERINKGRIVEPVP 111 >ref|XP_004958366.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X1 [Setaria italica] Length = 251 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIEPVP 103 DG+ V GREI VQFAKYGPNAERI+KGRI+EPVP Sbjct: 78 DGKLVDGREIMVQFAKYGPNAERINKGRIVEPVP 111 >gb|ESW31092.1| hypothetical protein PHAVU_002G208600g [Phaseolus vulgaris] gi|561032514|gb|ESW31093.1| hypothetical protein PHAVU_002G208600g [Phaseolus vulgaris] gi|561032515|gb|ESW31094.1| hypothetical protein PHAVU_002G208600g [Phaseolus vulgaris] Length = 268 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 DGRFVAGREITVQFAKYGPNAERIHKGRIIE 94 DGR V GREITVQFAKYGPNAERIHKGRIIE Sbjct: 78 DGRMVDGREITVQFAKYGPNAERIHKGRIIE 108