BLASTX nr result
ID: Jatropha_contig00026041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00026041 (666 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 154 3e-35 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 154 bits (388), Expect = 3e-35 Identities = 80/103 (77%), Positives = 85/103 (82%), Gaps = 2/103 (1%) Frame = -3 Query: 652 GILPPKTKGGGSPHLHSHSMEEQLLNPH--QKKISPDRYMMMLNRDQDRERGLPFCCVGS 479 GILP KTKGGGSPHLHSHSMEEQLLNPH Q + SPDRYMMMLNRDQDRERGLP C + Sbjct: 2 GILPQKTKGGGSPHLHSHSMEEQLLNPHYNQSQFSPDRYMMMLNRDQDRERGLPLCWLFE 61 Query: 478 SRQKHS*E*MVLIPMFFLVSFGFESLPLPVLTRLFQAVILDFF 350 ++ MVLIPMFFLVSFGFESLPL VLTRL +AVILDFF Sbjct: 62 AKALIG---MVLIPMFFLVSFGFESLPLHVLTRLLKAVILDFF 101