BLASTX nr result
ID: Jatropha_contig00025984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025984 (422 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528864.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002528864.1| conserved hypothetical protein [Ricinus communis] gi|223531715|gb|EEF33538.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 59.3 bits (142), Expect = 5e-07 Identities = 36/84 (42%), Positives = 46/84 (54%) Frame = +3 Query: 141 MERLKLLQTPSEQARLSXXXXXXXXXXXXXXXXXKDLNRKDEKENNTSPKSEIRELSRPS 320 MERL LL+TPSEQ+RL KDL+RKDE++ T +S++R SRPS Sbjct: 1 MERLMLLRTPSEQSRLLLEVPEIIADEPEVEPADKDLSRKDEQKKITMAESDLRRFSRPS 60 Query: 321 TKISRDNGISSSSNDGADFTGKSQ 392 ++ NGI ND ADF Q Sbjct: 61 SESPEGNGI-YCPNDTADFAEPMQ 83