BLASTX nr result
ID: Jatropha_contig00025854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025854 (321 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR59976.1| hypothetical protein CICLE_v10014506mg [Citrus cl... 177 9e-46 ref|XP_003539953.1| PREDICTED: GTP-binding protein TypA/BipA hom... 174 2e-45 ref|XP_003527397.1| PREDICTED: GTP-binding protein TypA/BipA hom... 174 2e-45 gb|EOX94166.1| Elongation factor family protein isoform 1 [Theob... 174 3e-45 gb|ERP54201.1| hypothetical protein POPTR_0013s12750g [Populus t... 174 3e-45 gb|EOX94167.1| Elongation factor family protein isoform 2 [Theob... 174 3e-45 gb|EOX94168.1| Elongation factor family protein isoform 3 [Theob... 174 3e-45 ref|XP_004505523.1| PREDICTED: GTP-binding protein TypA/BipA hom... 173 6e-45 ref|XP_002881151.1| GTP binding protein [Arabidopsis lyrata subs... 174 8e-45 ref|XP_006293809.1| hypothetical protein CARUB_v10022794mg [Caps... 173 8e-45 gb|ESQ51682.1| hypothetical protein EUTSA_v10016352mg [Eutrema s... 174 1e-44 ref|XP_004303094.1| PREDICTED: GTP-binding protein TypA/BipA hom... 174 2e-44 ref|XP_002525152.1| GTP-binding protein typa/bipa, putative [Ric... 173 2e-44 ref|NP_001189647.1| elongation factor family protein [Arabidopsi... 172 3e-44 ref|NP_001031452.1| elongation factor family protein [Arabidopsi... 172 3e-44 dbj|BAD43027.1| putative GTP-binding protein [Arabidopsis thaliana] 172 3e-44 ref|NP_180664.2| elongation factor family protein [Arabidopsis t... 172 3e-44 ref|XP_003607540.1| GTP-binding protein TypA/BipA-like protein [... 169 5e-44 ref|XP_003633251.1| PREDICTED: GTP-binding protein TypA/BipA hom... 176 1e-43 ref|XP_002278771.1| PREDICTED: GTP-binding protein TypA/BipA hom... 176 1e-43 >gb|ESR59976.1| hypothetical protein CICLE_v10014506mg [Citrus clementina] Length = 668 Score = 177 bits (449), Expect(2) = 9e-46 Identities = 90/91 (98%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL Sbjct: 142 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 201 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT EQLDFPVLYASAKEGWASSTFTK Sbjct: 202 FANLGATDEQLDFPVLYASAKEGWASSTFTK 232 Score = 32.0 bits (71), Expect(2) = 9e-46 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP D +NMSQLLDA Sbjct: 232 KDPPADVRNMSQLLDA 247 >ref|XP_003539953.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Glycine max] Length = 670 Score = 174 bits (442), Expect(2) = 2e-45 Identities = 88/91 (96%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEE CDEVESLVFDL Sbjct: 144 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEETCDEVESLVFDL 203 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWAS+TFTK Sbjct: 204 FANLGATEEQLDFPVLYASAKEGWASTTFTK 234 Score = 33.5 bits (75), Expect(2) = 2e-45 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DA+NMSQLLDA Sbjct: 234 KDPPADARNMSQLLDA 249 >ref|XP_003527397.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Glycine max] Length = 670 Score = 174 bits (442), Expect(2) = 2e-45 Identities = 88/91 (96%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEE CDEVESLVFDL Sbjct: 144 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEETCDEVESLVFDL 203 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWAS+TFTK Sbjct: 204 FANLGATEEQLDFPVLYASAKEGWASTTFTK 234 Score = 33.5 bits (75), Expect(2) = 2e-45 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DA+NMSQLLDA Sbjct: 234 KDPPADARNMSQLLDA 249 >gb|EOX94166.1| Elongation factor family protein isoform 1 [Theobroma cacao] Length = 665 Score = 174 bits (442), Expect(2) = 3e-45 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKAL YGLRPILLLNKVDRP+VSEERCDEVESLVFDL Sbjct: 139 MVEGAVLVVDAGEGPLAQTKFVLAKALNYGLRPILLLNKVDRPSVSEERCDEVESLVFDL 198 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 199 FANLGATEEQLDFPVLYASAKEGWASSTFTK 229 Score = 33.1 bits (74), Expect(2) = 3e-45 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP D KNMSQLLDA Sbjct: 229 KDPPADVKNMSQLLDA 244 >gb|ERP54201.1| hypothetical protein POPTR_0013s12750g [Populus trichocarpa] Length = 657 Score = 174 bits (442), Expect(2) = 3e-45 Identities = 88/91 (96%), Positives = 91/91 (100%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERC+EVESLVFDL Sbjct: 131 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCNEVESLVFDL 190 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASS+FTK Sbjct: 191 FANLGATEEQLDFPVLYASAKEGWASSSFTK 221 Score = 33.1 bits (74), Expect(2) = 3e-45 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP D KNMSQLLDA Sbjct: 221 KDPPADVKNMSQLLDA 236 >gb|EOX94167.1| Elongation factor family protein isoform 2 [Theobroma cacao] Length = 579 Score = 174 bits (442), Expect(2) = 3e-45 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKAL YGLRPILLLNKVDRP+VSEERCDEVESLVFDL Sbjct: 139 MVEGAVLVVDAGEGPLAQTKFVLAKALNYGLRPILLLNKVDRPSVSEERCDEVESLVFDL 198 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 199 FANLGATEEQLDFPVLYASAKEGWASSTFTK 229 Score = 33.1 bits (74), Expect(2) = 3e-45 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP D KNMSQLLDA Sbjct: 229 KDPPADVKNMSQLLDA 244 >gb|EOX94168.1| Elongation factor family protein isoform 3 [Theobroma cacao] Length = 558 Score = 174 bits (442), Expect(2) = 3e-45 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKAL YGLRPILLLNKVDRP+VSEERCDEVESLVFDL Sbjct: 139 MVEGAVLVVDAGEGPLAQTKFVLAKALNYGLRPILLLNKVDRPSVSEERCDEVESLVFDL 198 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 199 FANLGATEEQLDFPVLYASAKEGWASSTFTK 229 Score = 33.1 bits (74), Expect(2) = 3e-45 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP D KNMSQLLDA Sbjct: 229 KDPPADVKNMSQLLDA 244 >ref|XP_004505523.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Cicer arietinum] Length = 667 Score = 173 bits (439), Expect(2) = 6e-45 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAV+EE CDEVESLVFDL Sbjct: 141 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVTEEICDEVESLVFDL 200 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 201 FANLGATEEQLDFPVLYASAKEGWASSTFTK 231 Score = 33.1 bits (74), Expect(2) = 6e-45 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP +AKNMSQLLDA Sbjct: 231 KDPPAEAKNMSQLLDA 246 >ref|XP_002881151.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297326990|gb|EFH57410.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 667 Score = 174 bits (442), Expect(2) = 8e-45 Identities = 87/91 (95%), Positives = 91/91 (100%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 141 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 200 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASST+TK Sbjct: 201 FANLGATEEQLDFPVLYASAKEGWASSTYTK 231 Score = 31.6 bits (70), Expect(2) = 8e-45 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNM+ LLDA Sbjct: 231 KDPPADAKNMADLLDA 246 >ref|XP_006293809.1| hypothetical protein CARUB_v10022794mg [Capsella rubella] gi|482562517|gb|EOA26707.1| hypothetical protein CARUB_v10022794mg [Capsella rubella] Length = 664 Score = 173 bits (438), Expect(2) = 8e-45 Identities = 86/91 (94%), Positives = 91/91 (100%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 138 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 197 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQL+FPVLYASAKEGWASST+TK Sbjct: 198 FANLGATEEQLEFPVLYASAKEGWASSTYTK 228 Score = 33.1 bits (74), Expect(2) = 8e-45 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 K+PP DAKNMSQLLDA Sbjct: 228 KEPPVDAKNMSQLLDA 243 >gb|ESQ51682.1| hypothetical protein EUTSA_v10016352mg [Eutrema salsugineum] Length = 676 Score = 174 bits (440), Expect(2) = 1e-44 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+VSEERCDEVESLVFDL Sbjct: 150 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVSEERCDEVESLVFDL 209 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQL+FPVLYASAKEGW SSTFTK Sbjct: 210 FANLGATEEQLEFPVLYASAKEGWTSSTFTK 240 Score = 32.0 bits (71), Expect(2) = 1e-44 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 K+PP DA+NMSQLLDA Sbjct: 240 KEPPADARNMSQLLDA 255 >ref|XP_004303094.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Fragaria vesca subsp. vesca] Length = 670 Score = 174 bits (441), Expect(2) = 2e-44 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAV+EE CDEVESLVFDL Sbjct: 144 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVTEEMCDEVESLVFDL 203 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 204 FANLGATEEQLDFPVLYASAKEGWASSTFTK 234 Score = 30.8 bits (68), Expect(2) = 2e-44 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 K+PP D++NMSQLLDA Sbjct: 234 KEPPADSRNMSQLLDA 249 >ref|XP_002525152.1| GTP-binding protein typa/bipa, putative [Ricinus communis] gi|223535611|gb|EEF37279.1| GTP-binding protein typa/bipa, putative [Ricinus communis] Length = 661 Score = 173 bits (439), Expect(2) = 2e-44 Identities = 87/91 (95%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEE C+EVESLVFDL Sbjct: 135 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEEMCNEVESLVFDL 194 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 195 FANLGATEEQLDFPVLYASAKEGWASSTFTK 225 Score = 31.2 bits (69), Expect(2) = 2e-44 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLD 318 KDPP DAK+MSQLLD Sbjct: 225 KDPPADAKDMSQLLD 239 >ref|NP_001189647.1| elongation factor family protein [Arabidopsis thaliana] gi|330253392|gb|AEC08486.1| elongation factor family protein [Arabidopsis thaliana] Length = 671 Score = 172 bits (437), Expect(2) = 3e-44 Identities = 86/91 (94%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 145 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 204 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FAN GAT+EQLDFPVLYASAKEGWASST+TK Sbjct: 205 FANCGATEEQLDFPVLYASAKEGWASSTYTK 235 Score = 31.6 bits (70), Expect(2) = 3e-44 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNM+ LLDA Sbjct: 235 KDPPVDAKNMADLLDA 250 >ref|NP_001031452.1| elongation factor family protein [Arabidopsis thaliana] gi|330253391|gb|AEC08485.1| elongation factor family protein [Arabidopsis thaliana] Length = 667 Score = 172 bits (437), Expect(2) = 3e-44 Identities = 86/91 (94%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 141 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 200 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FAN GAT+EQLDFPVLYASAKEGWASST+TK Sbjct: 201 FANCGATEEQLDFPVLYASAKEGWASSTYTK 231 Score = 31.6 bits (70), Expect(2) = 3e-44 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNM+ LLDA Sbjct: 231 KDPPVDAKNMADLLDA 246 >dbj|BAD43027.1| putative GTP-binding protein [Arabidopsis thaliana] Length = 667 Score = 172 bits (437), Expect(2) = 3e-44 Identities = 86/91 (94%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 141 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 200 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FAN GAT+EQLDFPVLYASAKEGWASST+TK Sbjct: 201 FANCGATEEQLDFPVLYASAKEGWASSTYTK 231 Score = 31.6 bits (70), Expect(2) = 3e-44 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNM+ LLDA Sbjct: 231 KDPPVDAKNMADLLDA 246 >ref|NP_180664.2| elongation factor family protein [Arabidopsis thaliana] gi|190576479|gb|ACE79040.1| At2g31060 [Arabidopsis thaliana] gi|330253390|gb|AEC08484.1| elongation factor family protein [Arabidopsis thaliana] Length = 527 Score = 172 bits (437), Expect(2) = 3e-44 Identities = 86/91 (94%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP+V+EERCDEVESLVFDL Sbjct: 1 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPSVTEERCDEVESLVFDL 60 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FAN GAT+EQLDFPVLYASAKEGWASST+TK Sbjct: 61 FANCGATEEQLDFPVLYASAKEGWASSTYTK 91 Score = 31.6 bits (70), Expect(2) = 3e-44 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNM+ LLDA Sbjct: 91 KDPPVDAKNMADLLDA 106 >ref|XP_003607540.1| GTP-binding protein TypA/BipA-like protein [Medicago truncatula] gi|355508595|gb|AES89737.1| GTP-binding protein TypA/BipA-like protein [Medicago truncatula] Length = 737 Score = 169 bits (427), Expect(2) = 5e-44 Identities = 83/91 (91%), Positives = 90/91 (98%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAV++E CDEVES+VFDL Sbjct: 139 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVTQEICDEVESVVFDL 198 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWAS+T+TK Sbjct: 199 FANLGATEEQLDFPVLYASAKEGWASTTYTK 229 Score = 34.7 bits (78), Expect(2) = 5e-44 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 KDPP DAKNMSQLLDA Sbjct: 229 KDPPADAKNMSQLLDA 244 >ref|XP_003633251.1| PREDICTED: GTP-binding protein TypA/BipA homolog isoform 2 [Vitis vinifera] Length = 684 Score = 176 bits (447), Expect(2) = 1e-43 Identities = 88/91 (96%), Positives = 91/91 (100%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAV+EERCDEVESLVFDL Sbjct: 158 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVTEERCDEVESLVFDL 217 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 218 FANLGATEEQLDFPVLYASAKEGWASSTFTK 248 Score = 25.4 bits (54), Expect(2) = 1e-43 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 K PP + K+MS+LLDA Sbjct: 248 KSPPDNTKSMSELLDA 263 >ref|XP_002278771.1| PREDICTED: GTP-binding protein TypA/BipA homolog isoform 1 [Vitis vinifera] gi|302143376|emb|CBI21937.3| unnamed protein product [Vitis vinifera] Length = 672 Score = 176 bits (447), Expect(2) = 1e-43 Identities = 88/91 (96%), Positives = 91/91 (100%) Frame = +3 Query: 3 MVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVSEERCDEVESLVFDL 182 MVEGA+LVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAV+EERCDEVESLVFDL Sbjct: 146 MVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRPAVTEERCDEVESLVFDL 205 Query: 183 FANLGATKEQLDFPVLYASAKEGWASSTFTK 275 FANLGAT+EQLDFPVLYASAKEGWASSTFTK Sbjct: 206 FANLGATEEQLDFPVLYASAKEGWASSTFTK 236 Score = 25.4 bits (54), Expect(2) = 1e-43 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 274 KDPPTDAKNMSQLLDA 321 K PP + K+MS+LLDA Sbjct: 236 KSPPDNTKSMSELLDA 251