BLASTX nr result
ID: Jatropha_contig00025763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025763 (220 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 68 1e-09 gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba] 59 8e-07 ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncat... 59 8e-07 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 33/48 (68%) Frame = +2 Query: 68 YAWFARFYHCRAQSYSKEEFDPGSEGTLAICLNTCKSNVVFGELGRKK 211 YA F RFYHCRAQSYSKEEFDPGSEGTLAICL + G K Sbjct: 65 YARFTRFYHCRAQSYSKEEFDPGSEGTLAICLTHASRTLFSGSWAEGK 112 >gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 187 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 192 PKTTFDLHVFKHIASVPSEPGSNSSFEYDWALQW 91 P+ L KHIASVPSEPGSNSSFEYDWALQW Sbjct: 154 PENNVRLACVKHIASVPSEPGSNSSFEYDWALQW 187 >ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula] gi|355477374|gb|AES58577.1| ATP synthase subunit alpha [Medicago truncatula] Length = 1116 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 192 PKTTFDLHVFKHIASVPSEPGSNSSFEYDWALQW 91 P+ L KHIASVPSEPGSNSSFEYDWALQW Sbjct: 1083 PENNVRLACVKHIASVPSEPGSNSSFEYDWALQW 1116