BLASTX nr result
ID: Jatropha_contig00025664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025664 (629 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrio... 95 1e-17 ref|XP_003588269.1| Mitochondrial protein, putative [Medicago tr... 66 4e-13 emb|CAN80599.1| hypothetical protein VITISV_016761 [Vitis vinifera] 45 7e-08 emb|CAN67792.1| hypothetical protein VITISV_001313 [Vitis vinifera] 44 2e-07 >ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] gi|403311598|gb|AFR34346.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] Length = 106 Score = 95.1 bits (235), Expect = 1e-17 Identities = 56/80 (70%), Positives = 60/80 (75%), Gaps = 8/80 (10%) Frame = +2 Query: 194 GLLK--LRHFSANQKDWSCWMLLSAA-----ITTKKLCVELQPLRVGHGATASDAPHHCE 352 GLL+ LRHFSANQ + LL A +TTKKLCVELQPLRVGHGATASDAPHHC Sbjct: 29 GLLEGYLRHFSANQPEGL--ELLDVAQCCYKLTTKKLCVELQPLRVGHGATASDAPHHCG 86 Query: 353 KRGLAHQPT-LPRGGRIATT 409 +R LAHQPT LPR GR ATT Sbjct: 87 RRRLAHQPTFLPRRGRSATT 106 >ref|XP_003588269.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477317|gb|AES58520.1| Mitochondrial protein, putative [Medicago truncatula] Length = 172 Score = 65.9 bits (159), Expect(2) = 4e-13 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -1 Query: 374 ADGQAPSFRNGVGRQRLLPRGQLEGAEVRRRAFWLL 267 ADGQA S RNGVGRQRLLPR QLEGAEVRRRAFW L Sbjct: 39 ADGQASSCRNGVGRQRLLPRRQLEGAEVRRRAFWFL 74 Score = 34.7 bits (78), Expect(2) = 4e-13 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 277 FGCYSSTEQHPTAPVLLV 224 F YSSTEQHPTAPVLLV Sbjct: 73 FLIYSSTEQHPTAPVLLV 90 >emb|CAN80599.1| hypothetical protein VITISV_016761 [Vitis vinifera] Length = 1404 Score = 45.4 bits (106), Expect(2) = 7e-08 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +3 Query: 276 KSSASNFSPFELATGQQPLTPHTI 347 KS A+N SPFELATGQQPLTPHT+ Sbjct: 1198 KSEATNKSPFELATGQQPLTPHTL 1221 Score = 37.4 bits (85), Expect(2) = 7e-08 Identities = 16/32 (50%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +1 Query: 358 GACPSAY-FAKRWQDRNDLAQTHLDKAARRMK 450 G P+A+ FAK W ++ D+A+++LDKAA++MK Sbjct: 1227 GRSPAAFKFAKGWHEQADIARSYLDKAAKKMK 1258 >emb|CAN67792.1| hypothetical protein VITISV_001313 [Vitis vinifera] Length = 1414 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = +3 Query: 255 SVLL*QPKSSASNFSPFELATGQQPLTPHTI 347 S+++ +S A+N SPFELATGQQP+TPHT+ Sbjct: 1181 SIIVAVDRSEATNKSPFELATGQQPVTPHTL 1211 Score = 37.0 bits (84), Expect(2) = 2e-07 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 358 GACPSAY-FAKRWQDRNDLAQTHLDKAARRMKGATTLLGDNSKRSTK 495 G P+ + FAK W ++ D+A+++LDKAA++MK D +R TK Sbjct: 1217 GRSPATFKFAKGWHEQADIARSYLDKAAKKMK----KWADKKRRHTK 1259