BLASTX nr result
ID: Jatropha_contig00025568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025568 (197 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY24974.1| Hydroquinone glucosyltransferase, putative [Theob... 68 1e-09 ref|XP_002509937.1| nucleotide binding protein, putative [Ricinu... 68 1e-09 gb|EMJ10552.1| hypothetical protein PRUPE_ppa008587mg [Prunus pe... 65 7e-09 gb|ESR52620.1| hypothetical protein CICLE_v10021146mg [Citrus cl... 65 1e-08 ref|XP_002270960.2| PREDICTED: nucleoporin SEH1-like [Vitis vini... 64 2e-08 emb|CAN61200.1| hypothetical protein VITISV_003214 [Vitis vinifera] 64 2e-08 ref|XP_002303639.1| predicted protein [Populus trichocarpa] gi|1... 62 1e-07 gb|ERN08912.1| hypothetical protein AMTR_s00015p00235230 [Ambore... 61 1e-07 ref|XP_006343876.1| PREDICTED: nucleoporin seh1-A-like [Solanum ... 61 2e-07 ref|XP_004298888.1| PREDICTED: LOW QUALITY PROTEIN: nucleoporin ... 57 3e-06 ref|XP_003517499.1| PREDICTED: nucleoporin SEH1-like [Glycine max] 57 3e-06 gb|AFK36046.1| unknown [Lotus japonicus] 56 4e-06 gb|AFK35179.1| unknown [Lotus japonicus] 56 4e-06 dbj|BAJ10726.1| WD40 repeat nucleoporin similar to SEH1 [Lotus j... 56 4e-06 >gb|EOY24974.1| Hydroquinone glucosyltransferase, putative [Theobroma cacao] Length = 816 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CSAWNYCG+RLA GSVDGSLSI DSRD SSSF CSS Sbjct: 467 CSAWNYCGERLAAGSVDGSLSILDSRDSSSSSFICSS 503 >ref|XP_002509937.1| nucleotide binding protein, putative [Ricinus communis] gi|223549836|gb|EEF51324.1| nucleotide binding protein, putative [Ricinus communis] Length = 340 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CS+WNYCGQRLATGS+DG LSIFD RDPGSSSF +S Sbjct: 31 CSSWNYCGQRLATGSIDGYLSIFDPRDPGSSSFTRTS 67 >gb|EMJ10552.1| hypothetical protein PRUPE_ppa008587mg [Prunus persica] Length = 326 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CS+WNY QRLATGSVDG+L+IFD+RDP SSSF C+S Sbjct: 14 CSSWNYSSQRLATGSVDGTLAIFDTRDPASSSFSCTS 50 >gb|ESR52620.1| hypothetical protein CICLE_v10021146mg [Citrus clementina] Length = 325 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 88 SAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCS 192 S+WNYCGQRLATGS DG+LSIFDS DP SSSF C+ Sbjct: 15 SSWNYCGQRLATGSTDGTLSIFDSPDPSSSSFTCN 49 >ref|XP_002270960.2| PREDICTED: nucleoporin SEH1-like [Vitis vinifera] gi|297742315|emb|CBI34464.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CS+WNY G+RLATGSVDG+L+IFDS DP SSSF C+S Sbjct: 14 CSSWNYNGERLATGSVDGTLAIFDSIDPASSSFTCTS 50 >emb|CAN61200.1| hypothetical protein VITISV_003214 [Vitis vinifera] Length = 325 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CS+WNY G+RLATGSVDG+L+IFDS DP SSSF C+S Sbjct: 14 CSSWNYNGERLATGSVDGTLAIFDSIDPASSSFTCTS 50 >ref|XP_002303639.1| predicted protein [Populus trichocarpa] gi|118483516|gb|ABK93656.1| unknown [Populus trichocarpa] gi|222841071|gb|EEE78618.1| seh1 family protein [Populus trichocarpa] Length = 325 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 C++WNYCGQRLATGS +G LSIFDS DP SSSF +S Sbjct: 14 CTSWNYCGQRLATGSFNGFLSIFDSPDPASSSFTATS 50 >gb|ERN08912.1| hypothetical protein AMTR_s00015p00235230 [Amborella trichopoda] Length = 141 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 64 MQAGASPCSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 M+ GA CS+WNY GQR+A GS DG+LSI+DS DP S+SF C+S Sbjct: 9 MEKGAH-CSSWNYSGQRMAVGSTDGTLSIYDSDDPTSTSFSCTS 51 >ref|XP_006343876.1| PREDICTED: nucleoporin seh1-A-like [Solanum tuberosum] Length = 325 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 C+AWNY G RLA GS DG+LS+FDS DP SS F CSS Sbjct: 14 CTAWNYSGHRLAAGSTDGTLSLFDSTDPASSVFNCSS 50 >ref|XP_004298888.1| PREDICTED: LOW QUALITY PROTEIN: nucleoporin seh1-like [Fragaria vesca subsp. vesca] Length = 306 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSSFRCSS 195 CS+WNY GQRLATGS+DG+L+IFDS SSSF SS Sbjct: 14 CSSWNYSGQRLATGSLDGTLTIFDSPTXSSSSFSSSS 50 >ref|XP_003517499.1| PREDICTED: nucleoporin SEH1-like [Glycine max] Length = 326 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSS 180 C++WNY G RLA GSVDG+LSIFDSRDP SSS Sbjct: 14 CTSWNYSGTRLAAGSVDGTLSIFDSRDPPSSS 45 >gb|AFK36046.1| unknown [Lotus japonicus] Length = 326 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSS 180 CS+WNY G RLA GS DG+LSIFDSRDP SSS Sbjct: 14 CSSWNYSGTRLAAGSADGTLSIFDSRDPPSSS 45 >gb|AFK35179.1| unknown [Lotus japonicus] Length = 213 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSS 180 CS+WNY G RLA GS DG+LSIFDSRDP SSS Sbjct: 14 CSSWNYSGTRLAAGSADGTLSIFDSRDPPSSS 45 >dbj|BAJ10726.1| WD40 repeat nucleoporin similar to SEH1 [Lotus japonicus] Length = 326 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 85 CSAWNYCGQRLATGSVDGSLSIFDSRDPGSSS 180 CS+WNY G RLA GS DG+LSIFDSRDP SSS Sbjct: 14 CSSWNYSGTRLAAGSADGTLSIFDSRDPPSSS 45