BLASTX nr result
ID: Jatropha_contig00025528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025528 (515 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516175.1| transmembrane protein 14, putative [Ricinus ... 84 1e-14 >ref|XP_002516175.1| transmembrane protein 14, putative [Ricinus communis] gi|223544661|gb|EEF46177.1| transmembrane protein 14, putative [Ricinus communis] Length = 241 Score = 84.3 bits (207), Expect = 1e-14 Identities = 47/83 (56%), Positives = 62/83 (74%), Gaps = 2/83 (2%) Frame = +1 Query: 49 MAESVLGVASQSSLLLLEPSKFGFRTYTTPLTAIRLQQYSTGYRRFVVSSG--RNLKPVT 222 MAESV+G SQSSL++L+ SKFGFRT TP T IRL Q S RRF+VSS ++LKP++ Sbjct: 1 MAESVIGTVSQSSLIVLDSSKFGFRTCATPSTIIRLHQSSIENRRFLVSSADTKHLKPIS 60 Query: 223 AVRAVSSGFEAPTILNDNIDLST 291 AVSS F+A +++ DN+DLS+ Sbjct: 61 ---AVSSDFKASSLVTDNVDLSS 80