BLASTX nr result
ID: Jatropha_contig00025500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025500 (279 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 39 3e-06 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 38.5 bits (88), Expect(2) = 3e-06 Identities = 23/54 (42%), Positives = 26/54 (48%) Frame = +3 Query: 69 CILAYMPVHTPVGTDGTQL*LPCGYCFP*LPYYILGIPAFLA*PLIHTFASSGF 230 C PV + VGTDG L + F P LG+PA L PLIHTF F Sbjct: 227 CYFGTNPVDSKVGTDGPSL-IAKWVLFQLAPILTLGLPAILEEPLIHTFRLPAF 279 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +1 Query: 1 ASTGIIAFDDPGEQSAFIFMGPCVF 75 AS G ++F+DPGEQ+AF F+G C F Sbjct: 205 ASKGKVSFNDPGEQAAFSFLGKCYF 229