BLASTX nr result
ID: Jatropha_contig00025472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00025472 (569 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 98 2e-18 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 97.8 bits (242), Expect = 2e-18 Identities = 52/71 (73%), Positives = 56/71 (78%) Frame = -2 Query: 562 KISPDRYMMMLNRDQDRERGLPFCCVGSSRQKHS*E*MVLIPMFFLVSFGFESLPLPVLT 383 + SPDRYMMMLNRDQDRERGLP C + ++ MVLIPMFFLVSFGFESLPL VLT Sbjct: 34 QFSPDRYMMMLNRDQDRERGLPLCWLFEAKALIG---MVLIPMFFLVSFGFESLPLHVLT 90 Query: 382 RLF*AVILDFF 350 RL AVILDFF Sbjct: 91 RLLKAVILDFF 101